diff --git a/CHANGELOG.md b/CHANGELOG.md index e34223eba2..9610b211df 100644 --- a/CHANGELOG.md +++ b/CHANGELOG.md @@ -1,6 +1,49 @@ BioJava Changelog ----------------- +BioJava 7.2.4 +============================== +### Fixed +* Edge case in quaternary symmetry calculation #1120 + +BioJava 7.2.3 +============================== +### Fixed +* Don't use label_seq_id in mmCIF output for non-polymers #1116 + +BioJava 7.2.2 +============================== +### Fixed +* mmCIF parsing: entity type should be case insensitive #1109 +* Upgraded to latest version of ciftools-java, fixes mmCIF parsing performance issues in some edge cases https://github.com/rcsb/ciftools-java/issues/13 +* Added safeguards for `Structure.get*Chain*()` methods #1111 + +BioJava 7.2.1 +============================== +### Fixed +* More lenient mmCIF parsing to be able to parse [PDB-IHM](https://pdb-ihm.org/) entries, some more edge cases #1108 + +BioJava 7.2.0 +============================== +### Fixed +* More lenient mmCIF parsing to be able to parse [PDB-IHM](https://pdb-ihm.org/) entries #1106 +* Now AsaCalculator main constructor will use first model only instead of all #1107 + +### Added +* New constructor for AsaCalculator to provide Structure and model #1107 + +BioJava 7.1.4 +============================== +### Fixed +* More lenient mmCIF parsing, now can read files produced by [Gemmi](https://gemmi.readthedocs.io/en/latest/) #1103 +* Javadocs: all javadoc lint errors fixed +* Plugin updates and fixed issues in maven release process + +BioJava 7.1.3 +============================== +### Fixed +* Bug in symmetry detection #1101 and rcsb/symmetry#118 + BioJava 7.1.2 ============================== ### Fixed diff --git a/README.md b/README.md index cccff99106..eddeb65379 100644 --- a/README.md +++ b/README.md @@ -1,7 +1,7 @@ # Welcome to ![Build](https://github.com/biojava/biojava/actions/workflows/master.yml/badge.svg) -[![Version](http://img.shields.io/badge/version-7.1.1-blue.svg?style=flat)](https://github.com/biojava/biojava/releases/tag/biojava-7.1.1) [![License](http://img.shields.io/badge/license-LGPL_2.1-blue.svg?style=flat)](https://github.com/biojava/biojava/blob/master/LICENSE) [![Join the chat at https://gitter.im/biojava/biojava](https://badges.gitter.im/biojava/biojava.svg)](https://gitter.im/biojava/biojava?utm_source=badge&utm_medium=badge&utm_campaign=pr-badge&utm_content=badge) +[![Version](http://img.shields.io/badge/version-7.2.4-blue.svg?style=flat)](https://github.com/biojava/biojava/releases/tag/biojava-7.2.4) [![License](http://img.shields.io/badge/license-LGPL_2.1-blue.svg?style=flat)](https://github.com/biojava/biojava/blob/master/LICENSE) [![Join the chat at https://gitter.im/biojava/biojava](https://badges.gitter.im/biojava/biojava.svg)](https://gitter.im/biojava/biojava?utm_source=badge&utm_medium=badge&utm_campaign=pr-badge&utm_content=badge) BioJava is an open-source project dedicated to providing a Java framework for **processing biological data**. It provides analytical and statistical routines, parsers for common file formats, reference implementations of popular algorithms, and allows the manipulation of sequences and 3D structures. The goal of the biojava project is to facilitate rapid application development for bioinformatics. @@ -29,12 +29,22 @@ If you are using Maven you can add the BioJava repository by adding the followin org.biojava biojava-core - 7.1.1 + 7.2.4 ``` +### For developers + +Release biojava to maven central: +- `mvn -Prelease release:prepare` +- `mvn -Prelease release:perform` + +Publish new javadocs: +- `mvn -Prelease site` this will write `target/site` +- Push the contents of `target/site/apidocs` to the [biojava.github.io repo](https://github.com/biojava/biojava.github.io) under directory `docs/apiM.m.p` (e.g. docs/api7.1.4) and then link `docs/api` to `docs/apiM.m.p`, for it to be published in biojava.org + ### Mailing Lists BioJava has one main mailing list. In order to avoid SPAM the list only accepts postings from list members. Anybody can become a list member, so please subscribe before you post. If you send without being subscribed your mail might get stuck in the moderation loop, which can cause several weeks of delay (no fun to read through all that spam). diff --git a/biojava-aa-prop/pom.xml b/biojava-aa-prop/pom.xml index aef222e1a8..cbc82fff7b 100644 --- a/biojava-aa-prop/pom.xml +++ b/biojava-aa-prop/pom.xml @@ -2,7 +2,7 @@ biojava org.biojava - 7.1.2 + 7.2.5-SNAPSHOT 4.0.0 biojava-aa-prop @@ -70,12 +70,12 @@ org.biojava biojava-core - 7.1.2 + 7.2.5-SNAPSHOT org.biojava biojava-structure - 7.1.2 + 7.2.5-SNAPSHOT diff --git a/biojava-aa-prop/src/main/java/org/biojava/nbio/aaproperties/Constraints.java b/biojava-aa-prop/src/main/java/org/biojava/nbio/aaproperties/Constraints.java index d525c6bfe8..cecd981223 100644 --- a/biojava-aa-prop/src/main/java/org/biojava/nbio/aaproperties/Constraints.java +++ b/biojava-aa-prop/src/main/java/org/biojava/nbio/aaproperties/Constraints.java @@ -30,7 +30,7 @@ /** * This class is used to support the implementation of properties stated in IPeptideProperties. * It initializes several values that would be needed for the computation of properties such as - *

+ *

* Molecular weight
* Instability index
* Hydropathy value
diff --git a/biojava-aa-prop/src/main/java/org/biojava/nbio/aaproperties/IPeptideProperties.java b/biojava-aa-prop/src/main/java/org/biojava/nbio/aaproperties/IPeptideProperties.java index e90e7bd568..5342013b61 100644 --- a/biojava-aa-prop/src/main/java/org/biojava/nbio/aaproperties/IPeptideProperties.java +++ b/biojava-aa-prop/src/main/java/org/biojava/nbio/aaproperties/IPeptideProperties.java @@ -35,7 +35,7 @@ /** * An interface to generate some basic physico-chemical properties of protein sequences.
* The following properties could be generated: - *

+ *

* Molecular weight
* Absorbance
* Extinction coefficient
@@ -258,7 +258,7 @@ public AminoAcidCompositionTable obtainAminoAcidCompositionTable(File elementMas * Returns the net charge of sequence at pH 7. The sequence argument must be * a protein sequence consisting of only non-ambiguous characters. * The net charge will be computed using the approach stated in - * here * * pKa values used will be either * those used by Expasy which referenced "Electrophoresis 1994, 15, 529-539" diff --git a/biojava-aa-prop/src/main/java/org/biojava/nbio/aaproperties/profeat/IProfeatProperties.java b/biojava-aa-prop/src/main/java/org/biojava/nbio/aaproperties/profeat/IProfeatProperties.java index 0fab96f94a..7f39fff79e 100644 --- a/biojava-aa-prop/src/main/java/org/biojava/nbio/aaproperties/profeat/IProfeatProperties.java +++ b/biojava-aa-prop/src/main/java/org/biojava/nbio/aaproperties/profeat/IProfeatProperties.java @@ -28,7 +28,7 @@ public interface IProfeatProperties { /** * Based on Table 2 of http://nar.oxfordjournals.org/content/34/suppl_2/W32.full.pdf
* An interface class to generate the properties of a protein sequence based on its converted attributes.
- * The seven different attributes are

+ * The seven different attributes are

* Hydrophobicity (Polar, Neutral, Hydrophobicity)
* Normalized van der Waals volume (Range 0 - 2.78, 2.95 - 4.0, 4.03 - 8.08)
* Polarity (Value 4.9 - 6.2, 8.0 - 9.2, 10.4 - 13.0)
@@ -103,8 +103,8 @@ public enum DISTRIBUTION {FIRST, FIRST25, FIRST50, FIRST75, ALL}; * Computes and return the position with respect to the sequence where the given distribution of the grouping can be found.
* Example: "1111122222"
* For the above example,
- * position of the GROUPING.GROUP1 && DISTRIBUTION.FIRST = 0/10 (because the first occurrence of '1' is at position 0)
- * position of the GROUPING.GROUP1 && DISTRIBUTION.ALL = 4/10 (because all occurrences of '1' happens on and before position 4)
+ * position of the GROUPING.GROUP1 & DISTRIBUTION.FIRST = 0/10 (because the first occurrence of '1' is at position 0)
+ * position of the GROUPING.GROUP1 & DISTRIBUTION.ALL = 4/10 (because all occurrences of '1' happens on and before position 4)
* * @param sequence * a protein sequence consisting of non-ambiguous characters only diff --git a/biojava-aa-prop/src/main/java/org/biojava/nbio/aaproperties/profeat/ProfeatProperties.java b/biojava-aa-prop/src/main/java/org/biojava/nbio/aaproperties/profeat/ProfeatProperties.java index d8844476f4..dd0d310439 100644 --- a/biojava-aa-prop/src/main/java/org/biojava/nbio/aaproperties/profeat/ProfeatProperties.java +++ b/biojava-aa-prop/src/main/java/org/biojava/nbio/aaproperties/profeat/ProfeatProperties.java @@ -119,8 +119,8 @@ public static Map> getTransition(String seque * An adaptor method which computes and return the position with respect to the sequence where the given distribution of the grouping can be found.
* Example: "1111122222"
* For the above example,
- * position of the GROUPING.GROUP1 && DISTRIBUTION.FIRST = 0/10 (because the first occurrence of '1' is at position 0)
- * position of the GROUPING.GROUP1 && DISTRIBUTION.ALL = 4/10 (because all occurrences of '1' happens on and before position 4)
+ * position of the GROUPING.GROUP1 & DISTRIBUTION.FIRST = 0/10 (because the first occurrence of '1' is at position 0)
+ * position of the GROUPING.GROUP1 & DISTRIBUTION.ALL = 4/10 (because all occurrences of '1' happens on and before position 4)
* * @param sequence * a protein sequence consisting of non-ambiguous characters only diff --git a/biojava-aa-prop/src/main/java/org/biojava/nbio/aaproperties/profeat/convertor/Convertor.java b/biojava-aa-prop/src/main/java/org/biojava/nbio/aaproperties/profeat/convertor/Convertor.java index a88d93add3..e298ab2520 100644 --- a/biojava-aa-prop/src/main/java/org/biojava/nbio/aaproperties/profeat/convertor/Convertor.java +++ b/biojava-aa-prop/src/main/java/org/biojava/nbio/aaproperties/profeat/convertor/Convertor.java @@ -28,7 +28,7 @@ public abstract class Convertor { /** * Based on Table 2 of http://nar.oxfordjournals.org/content/34/suppl_2/W32.full.pdf
* An abstract class to convert a protein sequence into representation of different attribute with each attribute having 3 groups.
- * The seven different attributes are

+ * The seven different attributes are

* Hydrophobicity (Polar, Neutral, Hydrophobicity)
* Normalized van der Waals volume (Range 0 - 2.78, 2.95 - 4.0, 4.03 - 8.08)
* Polarity (Value 4.9 - 6.2, 8.0 - 9.2, 10.4 - 13.0)
diff --git a/biojava-aa-prop/src/main/java/org/biojava/nbio/aaproperties/profeat/convertor/package-info.java b/biojava-aa-prop/src/main/java/org/biojava/nbio/aaproperties/profeat/convertor/package-info.java index 22143b53cb..a28076aa41 100644 --- a/biojava-aa-prop/src/main/java/org/biojava/nbio/aaproperties/profeat/convertor/package-info.java +++ b/biojava-aa-prop/src/main/java/org/biojava/nbio/aaproperties/profeat/convertor/package-info.java @@ -20,7 +20,7 @@ */ /** * Set of classes that enable the conversion protein sequences into various attributes. - * The seven different attributes are

+ * The seven different attributes are

* Hydrophobicity (Polar, Neutral, Hydrophobicity)
* Normalized van der Waals volume (Range 0 - 2.78, 2.95 - 4.0, 4.03 - 8.08)
* Polarity (Value 4.9 - 6.2, 8.0 - 9.2, 10.4 - 13.0)
diff --git a/biojava-alignment/pom.xml b/biojava-alignment/pom.xml index 1700878845..b1d0bd9097 100644 --- a/biojava-alignment/pom.xml +++ b/biojava-alignment/pom.xml @@ -4,7 +4,7 @@ biojava org.biojava - 7.1.2 + 7.2.5-SNAPSHOT biojava-alignment biojava-alignment @@ -47,7 +47,7 @@ org.biojava biojava-core - 7.1.2 + 7.2.5-SNAPSHOT compile diff --git a/biojava-alignment/src/main/java/org/biojava/nbio/alignment/Alignments.java b/biojava-alignment/src/main/java/org/biojava/nbio/alignment/Alignments.java index 6cc2eb3f35..b389504826 100644 --- a/biojava-alignment/src/main/java/org/biojava/nbio/alignment/Alignments.java +++ b/biojava-alignment/src/main/java/org/biojava/nbio/alignment/Alignments.java @@ -122,7 +122,7 @@ private Alignments() { } * {@link ConcurrencyTools} utility. * * @param each {@link Sequence} of an alignment pair is of type S - * @param each element of an {@link AlignedSequence} is a {@link Compound} of type C + * @param each element of a sequence is a {@link Compound} of type C * @param sequences the {@link List} of {@link Sequence}s to align * @param type chosen type from list of pairwise sequence alignment routines * @param gapPenalty the gap penalties used during alignment @@ -203,7 +203,7 @@ public static , C extends Compound> Profile getMulti * Factory method which computes a sequence alignment for the given {@link Sequence} pair. * * @param each {@link Sequence} of the pair is of type S - * @param each element of an {@link AlignedSequence} is a {@link Compound} of type C + * @param each element of a sequence is a {@link Compound} of type C * @param query the first {@link Sequence}s to align * @param target the second {@link Sequence}s to align * @param type chosen type from list of pairwise sequence alignment routines @@ -223,7 +223,7 @@ public static , C extends Compound> SequencePair get * Factory method which sets up a sequence alignment for all {@link Sequence} pairs in the given {@link List}. * * @param each {@link Sequence} of an alignment pair is of type S - * @param each element of an {@link AlignedSequence} is a {@link Compound} of type C + * @param each element of a sequence is a {@link Compound} of type C * @param sequences the {@link List} of {@link Sequence}s to align * @param type chosen type from list of pairwise sequence alignment routines * @param gapPenalty the gap penalties used during alignment @@ -309,7 +309,7 @@ static List getListFromFutures(List> futures) { * Factory method which constructs a pairwise sequence aligner. * * @param each {@link Sequence} of an alignment pair is of type S - * @param each element of an {@link AlignedSequence} is a {@link Compound} of type C + * @param each element of a sequence is a {@link Compound} of type C * @param query the first {@link Sequence} to align * @param target the second {@link Sequence} to align * @param type chosen type from list of pairwise sequence alignment routines @@ -399,7 +399,7 @@ static , C extends Compound> PairwiseSequenceScorer * Factory method which constructs a profile-profile aligner. * * @param each {@link Sequence} of an alignment profile is of type S - * @param each element of an {@link AlignedSequence} is a {@link Compound} of type C + * @param each element of a sequence is a {@link Compound} of type C * @param profile1 the first {@link Profile} to align * @param profile2 the second {@link Profile} to align * @param type chosen type from list of profile-profile alignment routines @@ -429,7 +429,7 @@ static , C extends Compound> ProfileProfileAligner g * Factory method which constructs a profile-profile aligner. * * @param each {@link Sequence} of an alignment profile is of type S - * @param each element of an {@link AlignedSequence} is a {@link Compound} of type C + * @param each element of a sequence is a {@link Compound} of type C * @param profile1 the first {@link Profile} to align * @param profile2 the second {@link Profile} to align * @param type chosen type from list of profile-profile alignment routines @@ -459,7 +459,7 @@ static , C extends Compound> ProfileProfileAligner g * Factory method which constructs a profile-profile aligner. * * @param each {@link Sequence} of an alignment profile is of type S - * @param each element of an {@link AlignedSequence} is a {@link Compound} of type C + * @param each element of a sequence is a {@link Compound} of type C * @param profile1 the first {@link Profile} to align * @param profile2 the second {@link Profile} to align * @param type chosen type from list of profile-profile alignment routines @@ -489,7 +489,7 @@ static , C extends Compound> ProfileProfileAligner g * Factory method which constructs a profile-profile aligner. * * @param each {@link Sequence} of an alignment profile is of type S - * @param each element of an {@link AlignedSequence} is a {@link Compound} of type C + * @param each element of a sequence is a {@link Compound} of type C * @param profile1 the first {@link Profile} to align * @param profile2 the second {@link Profile} to align * @param type chosen type from list of profile-profile alignment routines @@ -519,7 +519,7 @@ static , C extends Compound> ProfileProfileAligner g * Factory method which computes a profile alignment for the given {@link Profile} pair. * * @param each {@link Sequence} of the {@link Profile} pair is of type S - * @param each element of an {@link AlignedSequence} is a {@link Compound} of type C + * @param each element of a sequence is a {@link Compound} of type C * @param profile1 the first {@link Profile} to align * @param profile2 the second {@link Profile} to align * @param type chosen type from list of profile-profile alignment routines @@ -539,7 +539,7 @@ static , C extends Compound> ProfilePair getProfileP * of the {@link ConcurrencyTools} utility. * * @param each {@link Sequence} of the {@link Profile} pair is of type S - * @param each element of an {@link AlignedSequence} is a {@link Compound} of type C + * @param each element of a sequence is a {@link Compound} of type C * @param tree guide tree to follow aligning profiles from leaves to root * @param type chosen type from list of profile-profile alignment routines * @param gapPenalty the gap penalties used during alignment @@ -592,7 +592,7 @@ public static , C extends Compound> Profile getProgr * submitting all of the alignment tasks to the shared thread pool of the {@link ConcurrencyTools} utility. * * @param each {@link Sequence} of an alignment pair is of type S - * @param each element of an {@link AlignedSequence} is a {@link Compound} of type C + * @param each element of a sequence is a {@link Compound} of type C * @param aligners list of alignments to run * @return list of {@link SequencePair} results from running alignments */ @@ -612,7 +612,7 @@ public static , C extends Compound> Profile getProgr * all of the scoring tasks to the shared thread pool of the {@link ConcurrencyTools} utility. * * @param each {@link Sequence} of an alignment pair is of type S - * @param each element of an {@link AlignedSequence} is a {@link Compound} of type C + * @param each element of a sequence is a {@link Compound} of type C * @param scorers list of scorers to run * @return list of score results from running scorers */ @@ -637,7 +637,7 @@ public static , C extends Compound> double[] runPairwiseSc * submitting all of the alignment tasks to the shared thread pool of the {@link ConcurrencyTools} utility. * * @param each {@link Sequence} of the {@link Profile} pair is of type S - * @param each element of an {@link AlignedSequence} is a {@link Compound} of type C + * @param each element of a sequence is a {@link Compound} of type C * @param aligners list of alignments to run * @return list of {@link ProfilePair} results from running alignments */ diff --git a/biojava-alignment/src/main/java/org/biojava/nbio/alignment/FractionalIdentityScorer.java b/biojava-alignment/src/main/java/org/biojava/nbio/alignment/FractionalIdentityScorer.java index 4b494db779..d66105681d 100644 --- a/biojava-alignment/src/main/java/org/biojava/nbio/alignment/FractionalIdentityScorer.java +++ b/biojava-alignment/src/main/java/org/biojava/nbio/alignment/FractionalIdentityScorer.java @@ -34,7 +34,7 @@ * * @author Mark Chapman * @param each {@link Sequence} of the alignment pair is of type S - * @param each element of an {@link AlignedSequence} is a {@link Compound} of type C + * @param each element of a sequence is a {@link Compound} of type C */ public class FractionalIdentityScorer, C extends Compound> extends AbstractScorer implements PairwiseSequenceScorer { diff --git a/biojava-alignment/src/main/java/org/biojava/nbio/alignment/FractionalSimilarityScorer.java b/biojava-alignment/src/main/java/org/biojava/nbio/alignment/FractionalSimilarityScorer.java index 05911367f8..e9581f1f96 100644 --- a/biojava-alignment/src/main/java/org/biojava/nbio/alignment/FractionalSimilarityScorer.java +++ b/biojava-alignment/src/main/java/org/biojava/nbio/alignment/FractionalSimilarityScorer.java @@ -34,7 +34,7 @@ * * @author Mark Chapman * @param each {@link Sequence} of the alignment pair is of type S - * @param each element of an {@link AlignedSequence} is a {@link Compound} of type C + * @param each element of a sequence is a {@link Compound} of type C */ public class FractionalSimilarityScorer, C extends Compound> extends AbstractScorer implements PairwiseSequenceScorer { diff --git a/biojava-alignment/src/main/java/org/biojava/nbio/alignment/SimpleProfileProfileAligner.java b/biojava-alignment/src/main/java/org/biojava/nbio/alignment/SimpleProfileProfileAligner.java index 47fb7976e0..ff94041bb8 100644 --- a/biojava-alignment/src/main/java/org/biojava/nbio/alignment/SimpleProfileProfileAligner.java +++ b/biojava-alignment/src/main/java/org/biojava/nbio/alignment/SimpleProfileProfileAligner.java @@ -41,7 +41,7 @@ * * @author Mark Chapman * @param each {@link Sequence} in the pair of alignment {@link Profile}s is of type S - * @param each element of an {@link AlignedSequence} is a {@link Compound} of type C + * @param each element of a sequence is a {@link Compound} of type C */ public class SimpleProfileProfileAligner, C extends Compound> extends AbstractProfileProfileAligner { diff --git a/biojava-alignment/src/main/java/org/biojava/nbio/alignment/io/StockholmFileAnnotation.java b/biojava-alignment/src/main/java/org/biojava/nbio/alignment/io/StockholmFileAnnotation.java index f0ca2bfa23..5b7ff9899b 100644 --- a/biojava-alignment/src/main/java/org/biojava/nbio/alignment/io/StockholmFileAnnotation.java +++ b/biojava-alignment/src/main/java/org/biojava/nbio/alignment/io/StockholmFileAnnotation.java @@ -160,7 +160,7 @@ public void setDbReferences(Set dbReferences) { this.dbReferences = dbReferences; } /** - * @param dbReference the string without the initial annotation identifier ( #=GS DR ) + * @param dbReferenceRepresentingString the string without the initial annotation identifier ( #=GS DR ) */ public void addDBReference(String dbReferenceRepresentingString) { if (this.dbReferences == null) { diff --git a/biojava-alignment/src/main/java/org/biojava/nbio/alignment/io/StockholmStructure.java b/biojava-alignment/src/main/java/org/biojava/nbio/alignment/io/StockholmStructure.java index d95a2bfa97..a70e751df5 100644 --- a/biojava-alignment/src/main/java/org/biojava/nbio/alignment/io/StockholmStructure.java +++ b/biojava-alignment/src/main/java/org/biojava/nbio/alignment/io/StockholmStructure.java @@ -38,7 +38,8 @@ * In general, Stockholm File contains the alignment mark-up lines.
*
* - * + *
+ * * * * @@ -56,18 +57,24 @@ * Sequence letters may include any characters except whitespace. Gaps may be indicated by "." or "-".
* Mark-up lines may include any characters except whitespace. Use underscore ("_") instead of space.
* - *
Header Section
+ *
+ * + * * * + * * * * + * * * * + * * * * + * * * * diff --git a/biojava-alignment/src/main/java/org/biojava/nbio/alignment/routines/AnchoredPairwiseSequenceAligner.java b/biojava-alignment/src/main/java/org/biojava/nbio/alignment/routines/AnchoredPairwiseSequenceAligner.java index 95d5264f1e..8533ecc91e 100644 --- a/biojava-alignment/src/main/java/org/biojava/nbio/alignment/routines/AnchoredPairwiseSequenceAligner.java +++ b/biojava-alignment/src/main/java/org/biojava/nbio/alignment/routines/AnchoredPairwiseSequenceAligner.java @@ -42,7 +42,7 @@ * will connect the query sequence to the target sequence at the anchors. This class performs such global * sequence comparisons efficiently by dynamic programming with a space requirement reduced from quadratic (a multiple * of query sequence length times target sequence length) to only linear (a multiple of query sequence length). The - * counterpoint to this reduction in space complexity is a modest (a multiple < 2) increase in time. + * counterpoint to this reduction in space complexity is a modest (a multiple < 2) increase in time. * * @author Mark Chapman * @author Daniel Cameron @@ -67,7 +67,6 @@ public AnchoredPairwiseSequenceAligner() { * @param target the second {@link Sequence} of the pair to align * @param gapPenalty the gap penalties used during alignment * @param subMatrix the set of substitution scores used during alignment - * @param cutsPerSection the number of cuts added to each section during each pass */ public AnchoredPairwiseSequenceAligner(S query, S target, GapPenalty gapPenalty, SubstitutionMatrix subMatrix) { this(query, target, gapPenalty, subMatrix, null); @@ -80,7 +79,6 @@ public AnchoredPairwiseSequenceAligner(S query, S target, GapPenalty gapPenalty, * @param target the second {@link Sequence} of the pair to align * @param gapPenalty the gap penalties used during alignment * @param subMatrix the set of substitution scores used during alignment - * @param cutsPerSection the number of cuts added to each section during each pass * @param anchors the initial list of anchors */ public AnchoredPairwiseSequenceAligner(S query, S target, GapPenalty gapPenalty, SubstitutionMatrix subMatrix, int[] anchors) { diff --git a/biojava-alignment/src/main/java/org/biojava/nbio/alignment/routines/GuanUberbacher.java b/biojava-alignment/src/main/java/org/biojava/nbio/alignment/routines/GuanUberbacher.java index 3ff44d8a8c..7e2d739db9 100644 --- a/biojava-alignment/src/main/java/org/biojava/nbio/alignment/routines/GuanUberbacher.java +++ b/biojava-alignment/src/main/java/org/biojava/nbio/alignment/routines/GuanUberbacher.java @@ -34,7 +34,7 @@ * {@link Compound} of each {@link Sequence}). This class performs such global sequence comparisons efficiently by * dynamic programming with a space requirement reduced from quadratic (a multiple of query sequence length times * target sequence length) to only linear (a multiple of query sequence length). The counterpoint to this reduction in - * space complexity is a modest (a multiple < 2) increase in time. + * space complexity is a modest (a multiple < 2) increase in time. * * @author Mark Chapman * @param each {@link Sequence} of the alignment pair is of type S diff --git a/biojava-alignment/src/main/java/org/biojava/nbio/alignment/template/AbstractMatrixAligner.java b/biojava-alignment/src/main/java/org/biojava/nbio/alignment/template/AbstractMatrixAligner.java index 19fcc9c98f..1ea2e0de81 100644 --- a/biojava-alignment/src/main/java/org/biojava/nbio/alignment/template/AbstractMatrixAligner.java +++ b/biojava-alignment/src/main/java/org/biojava/nbio/alignment/template/AbstractMatrixAligner.java @@ -46,7 +46,7 @@ * @author Mark Chapman * @author Daniel Cameron * @param each element of the alignment {@link Profile} is of type S - * @param each element of an {@link AlignedSequence} is a {@link Compound} of type C + * @param each element of a sequence is a {@link Compound} of type C */ public abstract class AbstractMatrixAligner, C extends Compound> extends AbstractScorer implements MatrixAligner { diff --git a/biojava-alignment/src/main/java/org/biojava/nbio/alignment/template/AbstractPairwiseSequenceAligner.java b/biojava-alignment/src/main/java/org/biojava/nbio/alignment/template/AbstractPairwiseSequenceAligner.java index 8c86470608..699ff77d36 100644 --- a/biojava-alignment/src/main/java/org/biojava/nbio/alignment/template/AbstractPairwiseSequenceAligner.java +++ b/biojava-alignment/src/main/java/org/biojava/nbio/alignment/template/AbstractPairwiseSequenceAligner.java @@ -37,7 +37,7 @@ * * @author Mark Chapman * @param each {@link Sequence} of the alignment pair is of type S - * @param each element of an {@link AlignedSequence} is a {@link Compound} of type C + * @param each element of a sequence is a {@link Compound} of type C */ public abstract class AbstractPairwiseSequenceAligner, C extends Compound> extends AbstractMatrixAligner implements PairwiseSequenceAligner { diff --git a/biojava-alignment/src/main/java/org/biojava/nbio/alignment/template/AbstractProfileProfileAligner.java b/biojava-alignment/src/main/java/org/biojava/nbio/alignment/template/AbstractProfileProfileAligner.java index 01cba48463..140627de9c 100644 --- a/biojava-alignment/src/main/java/org/biojava/nbio/alignment/template/AbstractProfileProfileAligner.java +++ b/biojava-alignment/src/main/java/org/biojava/nbio/alignment/template/AbstractProfileProfileAligner.java @@ -43,7 +43,7 @@ * * @author Mark Chapman * @param each {@link Sequence} in the pair of alignment {@link Profile}s is of type S - * @param each element of an {@link AlignedSequence} is a {@link Compound} of type C + * @param each element of a sequence is a {@link Compound} of type C */ public abstract class AbstractProfileProfileAligner, C extends Compound> extends AbstractMatrixAligner implements ProfileProfileAligner { diff --git a/biojava-alignment/src/main/java/org/biojava/nbio/alignment/template/Aligner.java b/biojava-alignment/src/main/java/org/biojava/nbio/alignment/template/Aligner.java index 75ec8b4df8..76e735c031 100644 --- a/biojava-alignment/src/main/java/org/biojava/nbio/alignment/template/Aligner.java +++ b/biojava-alignment/src/main/java/org/biojava/nbio/alignment/template/Aligner.java @@ -32,7 +32,7 @@ * * @author Mark Chapman * @param each element of the alignment {@link Profile} is of type S - * @param each element of an {@link AlignedSequence} is a {@link Compound} of type C + * @param each element of a sequence is a {@link Compound} of type C */ public interface Aligner, C extends Compound> extends Scorer { diff --git a/biojava-alignment/src/main/java/org/biojava/nbio/alignment/template/CallablePairwiseSequenceAligner.java b/biojava-alignment/src/main/java/org/biojava/nbio/alignment/template/CallablePairwiseSequenceAligner.java index e1c4616620..7201513800 100644 --- a/biojava-alignment/src/main/java/org/biojava/nbio/alignment/template/CallablePairwiseSequenceAligner.java +++ b/biojava-alignment/src/main/java/org/biojava/nbio/alignment/template/CallablePairwiseSequenceAligner.java @@ -34,7 +34,7 @@ * * @author Mark Chapman * @param each {@link Sequence} of the alignment pair is of type S - * @param each element of an {@link AlignedSequence} is a {@link Compound} of type C + * @param each element of a sequence is a {@link Compound} of type C */ public class CallablePairwiseSequenceAligner, C extends Compound> implements Callable> { diff --git a/biojava-alignment/src/main/java/org/biojava/nbio/alignment/template/CallableProfileProfileAligner.java b/biojava-alignment/src/main/java/org/biojava/nbio/alignment/template/CallableProfileProfileAligner.java index 063426a91a..042138f144 100644 --- a/biojava-alignment/src/main/java/org/biojava/nbio/alignment/template/CallableProfileProfileAligner.java +++ b/biojava-alignment/src/main/java/org/biojava/nbio/alignment/template/CallableProfileProfileAligner.java @@ -33,8 +33,8 @@ * Implements a concurrency wrapper for a {@link ProfileProfileAligner}. * * @author Mark Chapman - * @param each {@link Sequence} of the {@link Profile} pair is of type S - * @param each element of an {@link AlignedSequence} is a {@link Compound} of type C + * @param each {@link Sequence} of the profile pair is of type S + * @param each element of a sequence is a {@link Compound} of type C */ public class CallableProfileProfileAligner, C extends Compound> implements Callable> { diff --git a/biojava-alignment/src/main/java/org/biojava/nbio/alignment/template/MatrixAligner.java b/biojava-alignment/src/main/java/org/biojava/nbio/alignment/template/MatrixAligner.java index 87f9f504ce..dd8e38ceeb 100644 --- a/biojava-alignment/src/main/java/org/biojava/nbio/alignment/template/MatrixAligner.java +++ b/biojava-alignment/src/main/java/org/biojava/nbio/alignment/template/MatrixAligner.java @@ -30,8 +30,8 @@ * Defines an {@link Aligner} which builds a score matrix during computation. * * @author Mark Chapman - * @param each element of the alignment {@link Profile} is of type S - * @param each element of an {@link AlignedSequence} is a {@link Compound} of type C + * @param each element of the alignment profile is of type S + * @param each element of a sequence is a {@link Compound} of type C */ public interface MatrixAligner, C extends Compound> extends Aligner { diff --git a/biojava-alignment/src/main/java/org/biojava/nbio/alignment/template/PairInProfileScorer.java b/biojava-alignment/src/main/java/org/biojava/nbio/alignment/template/PairInProfileScorer.java index 094a18bead..4166bcfef4 100644 --- a/biojava-alignment/src/main/java/org/biojava/nbio/alignment/template/PairInProfileScorer.java +++ b/biojava-alignment/src/main/java/org/biojava/nbio/alignment/template/PairInProfileScorer.java @@ -32,7 +32,7 @@ * * @author Mark Chapman * @param each {@link Sequence} of the alignment pair is of type S - * @param each element of an {@link AlignedSequence} is a {@link Compound} of type C + * @param each element of a sequence is a {@link Compound} of type C */ public interface PairInProfileScorer, C extends Compound> extends PairwiseSequenceScorer { diff --git a/biojava-alignment/src/main/java/org/biojava/nbio/alignment/template/PairwiseSequenceAligner.java b/biojava-alignment/src/main/java/org/biojava/nbio/alignment/template/PairwiseSequenceAligner.java index 696ff6ecd8..960c3a527b 100644 --- a/biojava-alignment/src/main/java/org/biojava/nbio/alignment/template/PairwiseSequenceAligner.java +++ b/biojava-alignment/src/main/java/org/biojava/nbio/alignment/template/PairwiseSequenceAligner.java @@ -32,7 +32,7 @@ * * @author Mark Chapman * @param each {@link Sequence} of the alignment pair is of type S - * @param each element of an {@link AlignedSequence} is a {@link Compound} of type C + * @param each element of a sequence is a {@link Compound} of type C */ public interface PairwiseSequenceAligner, C extends Compound> extends Aligner, PairwiseSequenceScorer { diff --git a/biojava-alignment/src/main/java/org/biojava/nbio/alignment/template/PartitionRefiner.java b/biojava-alignment/src/main/java/org/biojava/nbio/alignment/template/PartitionRefiner.java index 573944b413..124f2ff132 100644 --- a/biojava-alignment/src/main/java/org/biojava/nbio/alignment/template/PartitionRefiner.java +++ b/biojava-alignment/src/main/java/org/biojava/nbio/alignment/template/PartitionRefiner.java @@ -28,11 +28,11 @@ import org.biojava.nbio.core.sequence.template.Sequence; /** - * Defines an algorithm which computes a new alignment {@link Profile} by splitting a current alignment and realigning. + * Defines an algorithm which computes a new alignment profile by splitting a current alignment and realigning. * * @author Mark Chapman - * @param each element of the alignment {@link Profile} is of type S - * @param each element of an {@link AlignedSequence} is a {@link Compound} of type C + * @param each element of the alignment profile is of type S + * @param each element of a sequence is a {@link Compound} of type C */ public interface PartitionRefiner, C extends Compound> extends Aligner, ProfileProfileScorer { diff --git a/biojava-alignment/src/main/java/org/biojava/nbio/alignment/template/ProfileProfileAligner.java b/biojava-alignment/src/main/java/org/biojava/nbio/alignment/template/ProfileProfileAligner.java index 6df23e0909..1e6fe7cccf 100644 --- a/biojava-alignment/src/main/java/org/biojava/nbio/alignment/template/ProfileProfileAligner.java +++ b/biojava-alignment/src/main/java/org/biojava/nbio/alignment/template/ProfileProfileAligner.java @@ -28,11 +28,11 @@ import org.biojava.nbio.core.sequence.template.Sequence; /** - * Defines an {@link Aligner} for a pair of {@link Profile}s. + * Defines an {@link Aligner} for a pair of profiles. * * @author Mark Chapman - * @param each {@link Sequence} in the pair of alignment {@link Profile}s is of type S - * @param each element of an {@link AlignedSequence} is a {@link Compound} of type C + * @param each {@link Sequence} in the pair of alignment profiles is of type S + * @param each element of a sequence is a {@link Compound} of type C */ public interface ProfileProfileAligner, C extends Compound> extends Aligner, ProfileProfileScorer { diff --git a/biojava-alignment/src/main/java/org/biojava/nbio/alignment/template/ProfileProfileScorer.java b/biojava-alignment/src/main/java/org/biojava/nbio/alignment/template/ProfileProfileScorer.java index 1d114841ee..c525b9c75a 100644 --- a/biojava-alignment/src/main/java/org/biojava/nbio/alignment/template/ProfileProfileScorer.java +++ b/biojava-alignment/src/main/java/org/biojava/nbio/alignment/template/ProfileProfileScorer.java @@ -32,7 +32,7 @@ * * @author Mark Chapman * @param each {@link Sequence} in the pair of alignment {@link Profile}s is of type S - * @param each element of an {@link AlignedSequence} is a {@link Compound} of type C + * @param each element of a sequence is a {@link Compound} of type C */ public interface ProfileProfileScorer, C extends Compound> extends Scorer { diff --git a/biojava-alignment/src/main/java/org/biojava/nbio/alignment/template/RescoreRefiner.java b/biojava-alignment/src/main/java/org/biojava/nbio/alignment/template/RescoreRefiner.java index dba02a028c..f93c000380 100644 --- a/biojava-alignment/src/main/java/org/biojava/nbio/alignment/template/RescoreRefiner.java +++ b/biojava-alignment/src/main/java/org/biojava/nbio/alignment/template/RescoreRefiner.java @@ -29,12 +29,12 @@ import org.biojava.nbio.core.sequence.template.Sequence; /** - * Defines an algorithm which computes a new alignment {@link Profile} by rescoring all pairs in an alignment and + * Defines an algorithm which computes a new alignment profile by rescoring all pairs in an alignment and * realigning. * * @author Mark Chapman - * @param each element of the alignment {@link Profile} is of type S - * @param each element of an {@link AlignedSequence} is a {@link Compound} of type C + * @param each element of the alignment profile is of type S + * @param each element of a sequence is a {@link Compound} of type C */ public interface RescoreRefiner, C extends Compound> extends Aligner { diff --git a/biojava-alignment/src/main/java/org/biojava/nbio/phylo/Comparison.java b/biojava-alignment/src/main/java/org/biojava/nbio/phylo/Comparison.java index dc8ead79a7..9cae7734cb 100644 --- a/biojava-alignment/src/main/java/org/biojava/nbio/phylo/Comparison.java +++ b/biojava-alignment/src/main/java/org/biojava/nbio/phylo/Comparison.java @@ -38,9 +38,9 @@ public class Comparison { /** * this is a gapped PID calculation * - * @param s1 + * @param seq1 * SequenceI - * @param s2 + * @param seq2 * SequenceI * @return float */ diff --git a/biojava-alignment/src/main/java/org/biojava/nbio/phylo/DistanceMatrixCalculator.java b/biojava-alignment/src/main/java/org/biojava/nbio/phylo/DistanceMatrixCalculator.java index d0464bae8b..922f301a8c 100644 --- a/biojava-alignment/src/main/java/org/biojava/nbio/phylo/DistanceMatrixCalculator.java +++ b/biojava-alignment/src/main/java/org/biojava/nbio/phylo/DistanceMatrixCalculator.java @@ -54,9 +54,9 @@ private DistanceMatrixCalculator() {} * that differ between two aligned sequences. The percentage of identity * (PID) is the fraction of identical sites between two aligned sequences. * - *
+	 * 
 	 * D = 1 - PID
-	 * 
+ * * * The gapped positons in the alignment are ignored in the calculation. This * method is a wrapper to the forester implementation of the calculation: @@ -65,7 +65,7 @@ private DistanceMatrixCalculator() {} * @param msa * MultipleSequenceAlignment * @return DistanceMatrix - * @throws Exception + * @throws IOException */ public static , D extends Compound> DistanceMatrix fractionalDissimilarity( MultipleSequenceAlignment msa) throws IOException { @@ -81,9 +81,9 @@ public static , D extends Compound> DistanceMatrix fractio * The Poisson (correction) evolutionary distance (d) is a function of the * fractional dissimilarity (D), given by: * - *
+	 * 
 	 * d = -log(1 - D)
-	 * 
+ * * * The gapped positons in the alignment are ignored in the calculation. This * method is a wrapper to the forester implementation of the calculation: @@ -109,14 +109,14 @@ public static , D extends Compound> DistanceMatrix poisson * dissimilarity (D) specially needed for large evolutionary distances. It * is given by: * - *
+	 * 
 	 * d = -log(1 - D - 0.2 * D2)
-	 * 
+ * * * The equation is derived by fitting the relationship between the * evolutionary distance (d) and the fractional dissimilarity (D) according * to the PAM model of evolution (it is an empirical approximation for the - * method {@link #pamDistance(MultipleSequenceAlignment}). The gapped + * method {@link #pamMLdistance(MultipleSequenceAlignment)}). The gapped * positons in the alignment are ignored in the calculation. This method is * a wrapper to the forester implementation of the calculation: * {@link PairwiseDistanceCalculator#calcKimuraDistances(Msa)}. @@ -190,9 +190,9 @@ public static , D extends Compound> DistanceMatrix percent * The fractional dissimilarity score (Ds) is a relative measure of the * dissimilarity between two aligned sequences. It is calculated as: * - *
+	 * 
 	 * Ds = sum( max(M) - Mai,bi ) / (max(M)-min(M)) ) / L
-	 * 
+ * * * Where the sum through i runs for all the alignment positions, ai and bi * are the AA at position i in the first and second aligned sequences, @@ -270,9 +270,9 @@ public static , D extends Compound> DistanceMatrix fractio * maximum similarity score between self-alignments (each sequence against * itself). Calculation of the score is as follows: * - *
+	 * 
 	 * Ds = maxScore - sumi(Mai,bi)
-	 * 
+ * * * It is recommended to use the method * {@link #fractionalDissimilarityScore(MultipleSequenceAlignment, SubstitutionMatrix)} @@ -362,9 +362,9 @@ public static , D extends Compound> DistanceMatrix dissimi * substitution rate of 1% per site. The fractional dissimilarity (D) of two * aligned sequences is related with the PAM distance (d) by the equation: * - *
+	 * 
 	 * D = sum(fi * (1 - Miid))
-	 * 
+ * * * Where the sum is for all 20 AA, fi denotes the natural fraction of the * given AA and M is the substitution matrix (in this case the PAM1 matrix). @@ -373,9 +373,9 @@ public static , D extends Compound> DistanceMatrix dissimi * likelihood (ML) approach is used, which consists in finding d that * maximazies the function: * - *
+	 * 
 	 * L(d) = product(fai * (1 - Mai,bid))
-	 * 
+ * * * Where the product is for every position i in the alignment, and ai and bi * are the AA at position i in the first and second aligned sequences, @@ -400,11 +400,11 @@ public static , D extends Compound> DistanceMatrix pamMLdi * strutures. It is based on the diffusive model for protein fold evolution * (Grishin 1995). The structural deviations are captured as RMS deviations. * - *
+	 * 
 	 * dSij = (rmsdmax2 / alpha2) *
 	 *        ln( (rmsdmax2 - rmsd02) /
 	 *        (rmsdmax2 - (rmsdij2) )
-	 * 
+ * * * @param rmsdMat * RMSD matrix for all structure pairs (symmetric matrix) diff --git a/biojava-core/pom.xml b/biojava-core/pom.xml index 6f7758ccc7..909f46f088 100644 --- a/biojava-core/pom.xml +++ b/biojava-core/pom.xml @@ -3,7 +3,7 @@ biojava org.biojava - 7.1.2 + 7.2.5-SNAPSHOT 4.0.0 biojava-core diff --git a/biojava-core/src/main/java/demo/UncompressFile.java b/biojava-core/src/main/java/demo/UncompressFile.java index bd36ee5983..7258d6d18b 100644 --- a/biojava-core/src/main/java/demo/UncompressFile.java +++ b/biojava-core/src/main/java/demo/UncompressFile.java @@ -38,7 +38,7 @@ public class UncompressFile { * Reads a file, uncompresses it, and sends the result to stdout. * Also writes trivial statistics to stderr. * @param args An array with one String element, the name of the file to read. - * @throws IOException for any failure + * @throws Exception for any failure */ public static void main(String[] args) throws Exception { diff --git a/biojava-core/src/main/java/org/biojava/nbio/core/alignment/SimpleAlignedSequence.java b/biojava-core/src/main/java/org/biojava/nbio/core/alignment/SimpleAlignedSequence.java index 85d0a03c26..99b70c036d 100644 --- a/biojava-core/src/main/java/org/biojava/nbio/core/alignment/SimpleAlignedSequence.java +++ b/biojava-core/src/main/java/org/biojava/nbio/core/alignment/SimpleAlignedSequence.java @@ -44,6 +44,7 @@ * * @author Mark Chapman * @param each element of the {@link Sequence} is a {@link Compound} of type C + * @param the sequence type */ public class SimpleAlignedSequence, C extends Compound> implements Serializable, AlignedSequence { @@ -410,7 +411,7 @@ private void setLocation(List steps) { } // combine sublocations into 1 Location - if (sublocations.size() == 0) { + if (sublocations.isEmpty()) { location = null; } else if (sublocations.size() == 1) { location = sublocations.get(0); diff --git a/biojava-core/src/main/java/org/biojava/nbio/core/alignment/SimpleProfile.java b/biojava-core/src/main/java/org/biojava/nbio/core/alignment/SimpleProfile.java index 4b853fcb37..7cfdb7dedc 100644 --- a/biojava-core/src/main/java/org/biojava/nbio/core/alignment/SimpleProfile.java +++ b/biojava-core/src/main/java/org/biojava/nbio/core/alignment/SimpleProfile.java @@ -159,7 +159,7 @@ protected SimpleProfile(Profile query, Profile target, List sx /** * Creates a profile for the already aligned sequences. * @param alignedSequences the already aligned sequences - * @throws IllegalArgument if aligned sequences differ in length or + * @throws IllegalArgumentException if aligned sequences differ in length or * collection is empty. */ public SimpleProfile(Collection> alignedSequences) { diff --git a/biojava-core/src/main/java/org/biojava/nbio/core/alignment/matrices/SubstitutionMatrixHelper.java b/biojava-core/src/main/java/org/biojava/nbio/core/alignment/matrices/SubstitutionMatrixHelper.java index 3f55a3897a..ab737b536e 100644 --- a/biojava-core/src/main/java/org/biojava/nbio/core/alignment/matrices/SubstitutionMatrixHelper.java +++ b/biojava-core/src/main/java/org/biojava/nbio/core/alignment/matrices/SubstitutionMatrixHelper.java @@ -78,7 +78,7 @@ public static SubstitutionMatrix getIdentity() { } /** - * Returns Blosum 100 matrix by Henikoff & Henikoff + * Returns Blosum 100 matrix by Henikoff & Henikoff * @return Blosum 100 matrix */ public static SubstitutionMatrix getBlosum100() { @@ -86,7 +86,7 @@ public static SubstitutionMatrix getBlosum100() { } /** - * Returns Blosum 30 matrix by Henikoff & Henikoff + * Returns Blosum 30 matrix by Henikoff & Henikoff * @return Blosum 30 matrix */ public static SubstitutionMatrix getBlosum30() { @@ -94,7 +94,7 @@ public static SubstitutionMatrix getBlosum30() { } /** - * Returns Blosum 35 matrix by Henikoff & Henikoff + * Returns Blosum 35 matrix by Henikoff & Henikoff * @return Blosum 35 matrix */ public static SubstitutionMatrix getBlosum35() { @@ -102,7 +102,7 @@ public static SubstitutionMatrix getBlosum35() { } /** - * Returns Blosum 40 matrix by Henikoff & Henikoff + * Returns Blosum 40 matrix by Henikoff & Henikoff * @return Blosum 40 matrix */ public static SubstitutionMatrix getBlosum40() { @@ -110,7 +110,7 @@ public static SubstitutionMatrix getBlosum40() { } /** - * Returns Blosum 45 matrix by Henikoff & Henikoff + * Returns Blosum 45 matrix by Henikoff & Henikoff * @return Blosum 45 matrix */ public static SubstitutionMatrix getBlosum45() { @@ -118,7 +118,7 @@ public static SubstitutionMatrix getBlosum45() { } /** - * Returns Blosum 50 matrix by Henikoff & Henikoff + * Returns Blosum 50 matrix by Henikoff & Henikoff * @return Blosum 50 matrix */ public static SubstitutionMatrix getBlosum50() { @@ -126,7 +126,7 @@ public static SubstitutionMatrix getBlosum50() { } /** - * Returns Blosum 55 matrix by Henikoff & Henikoff + * Returns Blosum 55 matrix by Henikoff & Henikoff * @return Blosum 55 matrix */ public static SubstitutionMatrix getBlosum55() { @@ -134,7 +134,7 @@ public static SubstitutionMatrix getBlosum55() { } /** - * Returns Blosum 60 matrix by Henikoff & Henikoff + * Returns Blosum 60 matrix by Henikoff & Henikoff * @return Blosum 60 matrix */ public static SubstitutionMatrix getBlosum60() { @@ -142,7 +142,7 @@ public static SubstitutionMatrix getBlosum60() { } /** - * Returns Blosum 62 matrix by Henikoff & Henikoff + * Returns Blosum 62 matrix by Henikoff & Henikoff * @return Blosum 62 matrix */ public static SubstitutionMatrix getBlosum62() { @@ -150,7 +150,7 @@ public static SubstitutionMatrix getBlosum62() { } /** - * Returns Blosum 65 matrix by Henikoff & Henikoff + * Returns Blosum 65 matrix by Henikoff & Henikoff * @return Blosum 65 matrix */ public static SubstitutionMatrix getBlosum65() { @@ -158,7 +158,7 @@ public static SubstitutionMatrix getBlosum65() { } /** - * Returns Blosum 70 matrix by Henikoff & Henikoff + * Returns Blosum 70 matrix by Henikoff & Henikoff * @return Blosum 70 matrix */ public static SubstitutionMatrix getBlosum70() { @@ -166,7 +166,7 @@ public static SubstitutionMatrix getBlosum70() { } /** - * Returns Blosum 75 matrix by Henikoff & Henikoff + * Returns Blosum 75 matrix by Henikoff & Henikoff * @return Blosum 75 matrix */ public static SubstitutionMatrix getBlosum75() { @@ -174,7 +174,7 @@ public static SubstitutionMatrix getBlosum75() { } /** - * Returns Blosum 80 matrix by Henikoff & Henikoff + * Returns Blosum 80 matrix by Henikoff & Henikoff * @return Blosum 80 matrix */ public static SubstitutionMatrix getBlosum80() { @@ -182,7 +182,7 @@ public static SubstitutionMatrix getBlosum80() { } /** - * Returns Blosum 85 matrix by Henikoff & Henikoff + * Returns Blosum 85 matrix by Henikoff & Henikoff * @return Blosum 85 matrix */ public static SubstitutionMatrix getBlosum85() { @@ -190,7 +190,7 @@ public static SubstitutionMatrix getBlosum85() { } /** - * Returns Blosum 90 matrix by Henikoff & Henikoff + * Returns Blosum 90 matrix by Henikoff & Henikoff * @return Blosum 90 matrix */ public static SubstitutionMatrix getBlosum90() { @@ -198,7 +198,7 @@ public static SubstitutionMatrix getBlosum90() { } /** - * Returns PAM 250 matrix by Gonnet, Cohen & Benner + * Returns PAM 250 matrix by Gonnet, Cohen & Benner * @return Gonnet 250 matrix */ public static SubstitutionMatrix getGonnet250() { diff --git a/biojava-core/src/main/java/org/biojava/nbio/core/alignment/template/AlignedSequence.java b/biojava-core/src/main/java/org/biojava/nbio/core/alignment/template/AlignedSequence.java index bc64496810..cbb959fd25 100644 --- a/biojava-core/src/main/java/org/biojava/nbio/core/alignment/template/AlignedSequence.java +++ b/biojava-core/src/main/java/org/biojava/nbio/core/alignment/template/AlignedSequence.java @@ -34,11 +34,12 @@ * @author Mark Chapman * @author Paolo Pavan * @param each element of the {@link Sequence} is a {@link Compound} of type C + * @param the sequence type */ public interface AlignedSequence, C extends Compound> extends Sequence { /** - * Defines an alignment step in order to pass alignment information from an {@link Aligner} to a constructor. + * Defines an alignment step in order to pass alignment information from an Aligner to a constructor. */ enum Step { COMPOUND, GAP } @@ -65,7 +66,7 @@ enum Step { COMPOUND, GAP } * * @param sequenceIndex index in the original {@link Sequence} * @return column index within an alignment - * @throws IndexOutOfBoundsException if sequenceIndex < 1 or sequenceIndex > + * @throws IndexOutOfBoundsException if sequenceIndex < 1 or sequenceIndex > * {@link #getOriginalSequence()}.{@link #getLength()} */ int getAlignmentIndexAt(int sequenceIndex); @@ -130,7 +131,7 @@ enum Step { COMPOUND, GAP } * * @param alignmentIndex column index within an alignment * @return index in the original {@link Sequence} - * @throws IndexOutOfBoundsException if alignmentIndex < 1 or alignmentIndex > {@link #getLength()} + * @throws IndexOutOfBoundsException if alignmentIndex < 1 or alignmentIndex > {@link #getLength()} */ int getSequenceIndexAt(int alignmentIndex); @@ -154,7 +155,7 @@ enum Step { COMPOUND, GAP } * * @param alignmentIndex column index within an alignment * @return true if this column has a gap - * @throws IndexOutOfBoundsException if alignmentIndex < 1 or alignmentIndex > {@link #getLength()} + * @throws IndexOutOfBoundsException if alignmentIndex < 1 or alignmentIndex > {@link #getLength()} */ boolean isGap(int alignmentIndex); diff --git a/biojava-core/src/main/java/org/biojava/nbio/core/alignment/template/MutableAlignedSequence.java b/biojava-core/src/main/java/org/biojava/nbio/core/alignment/template/MutableAlignedSequence.java index cfe85f7d33..edef1d54b7 100644 --- a/biojava-core/src/main/java/org/biojava/nbio/core/alignment/template/MutableAlignedSequence.java +++ b/biojava-core/src/main/java/org/biojava/nbio/core/alignment/template/MutableAlignedSequence.java @@ -34,6 +34,7 @@ * @author Mark Chapman * @author Paolo Pavan * @param each element of the {@link AlignedSequence} is a {@link Compound} of type C + * @param the sequence type */ public interface MutableAlignedSequence, C extends Compound> extends AlignedSequence { diff --git a/biojava-core/src/main/java/org/biojava/nbio/core/alignment/template/Profile.java b/biojava-core/src/main/java/org/biojava/nbio/core/alignment/template/Profile.java index 811de73b31..62575a1bf2 100644 --- a/biojava-core/src/main/java/org/biojava/nbio/core/alignment/template/Profile.java +++ b/biojava-core/src/main/java/org/biojava/nbio/core/alignment/template/Profile.java @@ -58,7 +58,7 @@ enum StringFormat { * * @param listIndex index of sequence in profile * @return desired sequence - * @throws IndexOutOfBoundsException if listIndex < 1 or listIndex > number of sequences + * @throws IndexOutOfBoundsException if listIndex < 1 or listIndex > number of sequences */ AlignedSequence getAlignedSequence(int listIndex); @@ -101,8 +101,8 @@ enum StringFormat { * @param listIndex index of sequence in profile * @param alignmentIndex column index within an alignment * @return the sequence element - * @throws IndexOutOfBoundsException if listIndex < 1, listIndex > number of sequences, alignmentIndex < 1, or - * alignmentIndex > {@link #getLength()} + * @throws IndexOutOfBoundsException if listIndex < 1, listIndex > number of sequences, alignmentIndex < 1, or + * alignmentIndex > {@link #getLength()} */ C getCompoundAt(int listIndex, int alignmentIndex); @@ -113,7 +113,7 @@ enum StringFormat { * @param sequence either an {@link AlignedSequence} or an original {@link Sequence} * @param alignmentIndex column index within an alignment * @return the sequence element - * @throws IndexOutOfBoundsException if alignmentIndex < 1 or alignmentIndex > {@link #getLength()} + * @throws IndexOutOfBoundsException if alignmentIndex < 1 or alignmentIndex > {@link #getLength()} */ C getCompoundAt(S sequence, int alignmentIndex); @@ -122,7 +122,7 @@ enum StringFormat { * * @param alignmentIndex column index within an alignment * @return list of counts - * @throws IndexOutOfBoundsException if alignmentIndex < 1 or alignmentIndex > {@link #getLength()} + * @throws IndexOutOfBoundsException if alignmentIndex < 1 or alignmentIndex > {@link #getLength()} */ int[] getCompoundCountsAt(int alignmentIndex); @@ -132,7 +132,7 @@ enum StringFormat { * @param alignmentIndex column index within an alignment * @param compounds list of compounds to count * @return corresponding list of counts - * @throws IndexOutOfBoundsException if alignmentIndex < 1 or alignmentIndex > {@link #getLength()} + * @throws IndexOutOfBoundsException if alignmentIndex < 1 or alignmentIndex > {@link #getLength()} */ int[] getCompoundCountsAt(int alignmentIndex, List compounds); @@ -141,7 +141,7 @@ enum StringFormat { * * @param alignmentIndex column index within an alignment * @return the sequence elements - * @throws IndexOutOfBoundsException if alignmentIndex < 1 or alignmentIndex > {@link #getLength()} + * @throws IndexOutOfBoundsException if alignmentIndex < 1 or alignmentIndex > {@link #getLength()} */ List getCompoundsAt(int alignmentIndex); @@ -157,7 +157,7 @@ enum StringFormat { * * @param alignmentIndex column index within an alignment * @return list of fractional weights - * @throws IndexOutOfBoundsException if alignmentIndex < 1 or alignmentIndex > {@link #getLength()} + * @throws IndexOutOfBoundsException if alignmentIndex < 1 or alignmentIndex > {@link #getLength()} */ float[] getCompoundWeightsAt(int alignmentIndex); @@ -167,7 +167,7 @@ enum StringFormat { * @param alignmentIndex column index within an alignment * @param compounds list of compounds to count * @return corresponding list of fractional weights - * @throws IndexOutOfBoundsException if alignmentIndex < 1 or alignmentIndex > {@link #getLength()} + * @throws IndexOutOfBoundsException if alignmentIndex < 1 or alignmentIndex > {@link #getLength()} */ float[] getCompoundWeightsAt(int alignmentIndex, List compounds); @@ -177,7 +177,7 @@ enum StringFormat { * * @param alignmentIndex column index within an alignment * @return the sequence indices - * @throws IndexOutOfBoundsException if alignmentIndex < 1 or alignmentIndex > {@link #getLength()} + * @throws IndexOutOfBoundsException if alignmentIndex < 1 or alignmentIndex > {@link #getLength()} */ int[] getIndicesAt(int alignmentIndex); @@ -236,7 +236,7 @@ enum StringFormat { * * @param alignmentIndex column index within an alignment * @return true if any {@link AlignedSequence} has a gap at the given index - * @throws IndexOutOfBoundsException if alignmentIndex < 1 or alignmentIndex > {@link #getLength()} + * @throws IndexOutOfBoundsException if alignmentIndex < 1 or alignmentIndex > {@link #getLength()} */ boolean hasGap(int alignmentIndex); diff --git a/biojava-core/src/main/java/org/biojava/nbio/core/alignment/template/SequencePair.java b/biojava-core/src/main/java/org/biojava/nbio/core/alignment/template/SequencePair.java index 24f2315e00..1367fb6be9 100644 --- a/biojava-core/src/main/java/org/biojava/nbio/core/alignment/template/SequencePair.java +++ b/biojava-core/src/main/java/org/biojava/nbio/core/alignment/template/SequencePair.java @@ -41,7 +41,7 @@ public interface SequencePair, C extends Compound> extends * * @param alignmentIndex column index in alignment * @return the query sequence element - * @throws IndexOutOfBoundsException if alignmentIndex < 1 or alignmentIndex > {@link #getLength()} + * @throws IndexOutOfBoundsException if alignmentIndex < 1 or alignmentIndex > {@link #getLength()} */ C getCompoundInQueryAt(int alignmentIndex); @@ -50,7 +50,7 @@ public interface SequencePair, C extends Compound> extends * * @param alignmentIndex column index in alignment * @return the target sequence element - * @throws IndexOutOfBoundsException if alignmentIndex < 1 or alignmentIndex > {@link #getLength()} + * @throws IndexOutOfBoundsException if alignmentIndex < 1 or alignmentIndex > {@link #getLength()} */ C getCompoundInTargetAt(int alignmentIndex); @@ -59,7 +59,7 @@ public interface SequencePair, C extends Compound> extends * * @param alignmentIndex column index in alignment * @return index in query {@link Sequence} - * @throws IndexOutOfBoundsException if alignmentIndex < 1 or alignmentIndex > {@link #getLength()} + * @throws IndexOutOfBoundsException if alignmentIndex < 1 or alignmentIndex > {@link #getLength()} */ int getIndexInQueryAt(int alignmentIndex); @@ -68,7 +68,7 @@ public interface SequencePair, C extends Compound> extends * * @param targetIndex index in target {@link Sequence} * @return index in query {@link Sequence} - * @throws IndexOutOfBoundsException if targetIndex < 1 or targetIndex > {@link #getTarget()}.getLength() + * @throws IndexOutOfBoundsException if targetIndex < 1 or targetIndex > {@link #getTarget()}.getLength() */ int getIndexInQueryForTargetAt(int targetIndex); @@ -77,7 +77,7 @@ public interface SequencePair, C extends Compound> extends * * @param alignmentIndex column index in alignment * @return index in target {@link Sequence} - * @throws IndexOutOfBoundsException if alignmentIndex < 1 or alignmentIndex > {@link #getLength()} + * @throws IndexOutOfBoundsException if alignmentIndex < 1 or alignmentIndex > {@link #getLength()} */ int getIndexInTargetAt(int alignmentIndex); @@ -86,7 +86,7 @@ public interface SequencePair, C extends Compound> extends * * @param queryIndex index in query {@link Sequence} * @return index in target {@link Sequence} - * @throws IndexOutOfBoundsException if queryIndex < 1 or queryIndex > {@link #getQuery()}.getLength() + * @throws IndexOutOfBoundsException if queryIndex < 1 or queryIndex > {@link #getQuery()}.getLength() */ int getIndexInTargetForQueryAt(int queryIndex); diff --git a/biojava-core/src/main/java/org/biojava/nbio/core/alignment/template/SubstitutionMatrix.java b/biojava-core/src/main/java/org/biojava/nbio/core/alignment/template/SubstitutionMatrix.java index 22a8de5f5c..436fc7a44b 100644 --- a/biojava-core/src/main/java/org/biojava/nbio/core/alignment/template/SubstitutionMatrix.java +++ b/biojava-core/src/main/java/org/biojava/nbio/core/alignment/template/SubstitutionMatrix.java @@ -103,7 +103,7 @@ public interface SubstitutionMatrix { * Rescales the matrix so that to {@link #getMaxValue()} - {@link #getMinValue()} = scale. * * @param scale new normalization scale of this matrix - * @throws IllegalArgumentException if scale < 1 + * @throws IllegalArgumentException if scale < 1 */ SubstitutionMatrix normalizeMatrix(short scale); diff --git a/biojava-core/src/main/java/org/biojava/nbio/core/exceptions/ParserException.java b/biojava-core/src/main/java/org/biojava/nbio/core/exceptions/ParserException.java index acd8cc47fb..5afaa7c412 100644 --- a/biojava-core/src/main/java/org/biojava/nbio/core/exceptions/ParserException.java +++ b/biojava-core/src/main/java/org/biojava/nbio/core/exceptions/ParserException.java @@ -23,7 +23,7 @@ */ /** * General abstraction of different parsing errors - * @author Scooter Willis + * @author Scooter Willis */ public class ParserException extends RuntimeException { diff --git a/biojava-core/src/main/java/org/biojava/nbio/core/search/io/Hsp.java b/biojava-core/src/main/java/org/biojava/nbio/core/search/io/Hsp.java index 7a27828feb..832997bb2b 100644 --- a/biojava-core/src/main/java/org/biojava/nbio/core/search/io/Hsp.java +++ b/biojava-core/src/main/java/org/biojava/nbio/core/search/io/Hsp.java @@ -40,15 +40,16 @@ /** * This class models a search Hsp. * You will retrieve a list of this using iterator of a Hit - * + *

* Designed by Paolo Pavan. * You may want to find my contacts on Github and LinkedIn for code info * or discuss major changes. * https://github.com/paolopavan * * @author Paolo Pavan + * @param the compound type + * @param the sequence type */ - public abstract class Hsp , C extends Compound> { private static final Logger logger = LoggerFactory.getLogger(Hsp.class); private Integer hspNum; diff --git a/biojava-core/src/main/java/org/biojava/nbio/core/search/io/ResultFactory.java b/biojava-core/src/main/java/org/biojava/nbio/core/search/io/ResultFactory.java index 479df1ac4d..d9279b8cce 100644 --- a/biojava-core/src/main/java/org/biojava/nbio/core/search/io/ResultFactory.java +++ b/biojava-core/src/main/java/org/biojava/nbio/core/search/io/ResultFactory.java @@ -34,7 +34,6 @@ * * @author Paolo Pavan */ - public interface ResultFactory { /** * returns a list of file extensions associated to this ResultFactory @@ -49,7 +48,8 @@ public interface ResultFactory { * * @param maxEScore * @return - * @throws Exception + * @throws IOException + * @throws ParseException */ List createObjects(double maxEScore) throws IOException, ParseException; /** @@ -57,7 +57,8 @@ public interface ResultFactory { * to a file in the same format that it is able to read. * * @param results - * @throws Exception + * @throws IOException + * @throws ParseException */ void storeObjects(List results) throws IOException, ParseException; diff --git a/biojava-core/src/main/java/org/biojava/nbio/core/search/io/SearchIO.java b/biojava-core/src/main/java/org/biojava/nbio/core/search/io/SearchIO.java index 95ffb9fcfc..e864068afd 100644 --- a/biojava-core/src/main/java/org/biojava/nbio/core/search/io/SearchIO.java +++ b/biojava-core/src/main/java/org/biojava/nbio/core/search/io/SearchIO.java @@ -64,7 +64,6 @@ public class SearchIO implements Iterable{ * file extension. * * @param f - * @throws Exception */ public SearchIO (File f) throws IOException, ParseException{ factory = guessFactory(f); diff --git a/biojava-core/src/main/java/org/biojava/nbio/core/search/io/blast/BlastXMLParser.java b/biojava-core/src/main/java/org/biojava/nbio/core/search/io/blast/BlastXMLParser.java index 73932d9147..5ccd89f459 100644 --- a/biojava-core/src/main/java/org/biojava/nbio/core/search/io/blast/BlastXMLParser.java +++ b/biojava-core/src/main/java/org/biojava/nbio/core/search/io/blast/BlastXMLParser.java @@ -43,7 +43,7 @@ /** * Re-designed by Paolo Pavan on the footprint of: - * org.biojava.nbio.genome.query.BlastXMLQuery by Scooter Willis + * org.biojava.nbio.genome.query.BlastXMLQuery by Scooter Willis * * You may want to find my contacts on Github and LinkedIn for code info * or discuss major changes. diff --git a/biojava-core/src/main/java/org/biojava/nbio/core/sequence/CDSComparator.java b/biojava-core/src/main/java/org/biojava/nbio/core/sequence/CDSComparator.java index 8acb7a7e83..0342ec7a46 100644 --- a/biojava-core/src/main/java/org/biojava/nbio/core/sequence/CDSComparator.java +++ b/biojava-core/src/main/java/org/biojava/nbio/core/sequence/CDSComparator.java @@ -18,7 +18,7 @@ * http://www.biojava.org/ * * Created on 3/1/2010 - * @author Scooter Willis + * @author Scooter Willis */ package org.biojava.nbio.core.sequence; diff --git a/biojava-core/src/main/java/org/biojava/nbio/core/sequence/CDSSequence.java b/biojava-core/src/main/java/org/biojava/nbio/core/sequence/CDSSequence.java index f897622f3c..2fbd638b82 100644 --- a/biojava-core/src/main/java/org/biojava/nbio/core/sequence/CDSSequence.java +++ b/biojava-core/src/main/java/org/biojava/nbio/core/sequence/CDSSequence.java @@ -32,7 +32,7 @@ * Represents a exon or coding sequence in a gene. It has a parent {@link TranscriptSequence} * where a TranscriptSequence is the child of a GeneSequence * Not important for protein construction but the phase is used if outputting the gene - * to a gff3 file. {@link http://www.sequenceontology.org/gff3.shtml} + * to a gff3 file. http://www.sequenceontology.org/gff3.shtml * @author Scooter Willis */ public class CDSSequence extends DNASequence { @@ -90,8 +90,8 @@ public Strand getStrand() { * A CDS sequence if negative stranded needs to be reverse complement * to represent the actual coding sequence. When getting a ProteinSequence * from a TranscriptSequence this method is callled for each CDSSequence - * {@link http://www.sequenceontology.org/gff3.shtml} - * {@link http://biowiki.org/~yam/bioe131/GFF.ppt} + * http://www.sequenceontology.org/gff3.shtml + * http://biowiki.org/~yam/bioe131/GFF.ppt * @return coding sequence */ public String getCodingSequence() { diff --git a/biojava-core/src/main/java/org/biojava/nbio/core/sequence/DataSource.java b/biojava-core/src/main/java/org/biojava/nbio/core/sequence/DataSource.java index 000adce936..9086382155 100644 --- a/biojava-core/src/main/java/org/biojava/nbio/core/sequence/DataSource.java +++ b/biojava-core/src/main/java/org/biojava/nbio/core/sequence/DataSource.java @@ -35,8 +35,8 @@ * General database identifier gnl|database|identifier * NCBI Reference Sequence ref|accession|locus * Local Sequence identifier lcl|identifier - * - * @author Scooter Willis + * + * @author Scooter Willis */ public enum DataSource { diff --git a/biojava-core/src/main/java/org/biojava/nbio/core/sequence/ExonComparator.java b/biojava-core/src/main/java/org/biojava/nbio/core/sequence/ExonComparator.java index 64495b251f..43389f433c 100644 --- a/biojava-core/src/main/java/org/biojava/nbio/core/sequence/ExonComparator.java +++ b/biojava-core/src/main/java/org/biojava/nbio/core/sequence/ExonComparator.java @@ -30,7 +30,7 @@ /** * Sort Exon where it is a little confusing if exons should always be ordered left to right * where a negative stranded gene should go the other direction. Need to think about this? - * @author Scooter Willis + * @author Scooter Willis */ public class ExonComparator implements Comparator, Serializable{ private static final long serialVersionUID = 1; diff --git a/biojava-core/src/main/java/org/biojava/nbio/core/sequence/GeneSequence.java b/biojava-core/src/main/java/org/biojava/nbio/core/sequence/GeneSequence.java index f0f2662fea..638e4e68d9 100644 --- a/biojava-core/src/main/java/org/biojava/nbio/core/sequence/GeneSequence.java +++ b/biojava-core/src/main/java/org/biojava/nbio/core/sequence/GeneSequence.java @@ -119,7 +119,7 @@ public void addIntronsUsingExons() throws Exception { if (intronAdded) { //going to assume introns are correct return; } - if (exonSequenceList.size() == 0) { + if (exonSequenceList.isEmpty()) { return; } ExonComparator exonComparator = new ExonComparator(); diff --git a/biojava-core/src/main/java/org/biojava/nbio/core/sequence/RNASequence.java b/biojava-core/src/main/java/org/biojava/nbio/core/sequence/RNASequence.java index a3e706716b..318df7cf9f 100644 --- a/biojava-core/src/main/java/org/biojava/nbio/core/sequence/RNASequence.java +++ b/biojava-core/src/main/java/org/biojava/nbio/core/sequence/RNASequence.java @@ -39,7 +39,7 @@ /** * RNASequence where RNACompoundSet are the allowed values - * @author Scooter Willis + * @author Scooter Willis */ public class RNASequence extends AbstractSequence { diff --git a/biojava-core/src/main/java/org/biojava/nbio/core/sequence/SequenceComparator.java b/biojava-core/src/main/java/org/biojava/nbio/core/sequence/SequenceComparator.java index 066aa930de..742b47bfce 100644 --- a/biojava-core/src/main/java/org/biojava/nbio/core/sequence/SequenceComparator.java +++ b/biojava-core/src/main/java/org/biojava/nbio/core/sequence/SequenceComparator.java @@ -29,7 +29,7 @@ /** * Used to sort sequences in ascending order of bioBegin property. - * @author Scooter Willis + * @author Scooter Willis */ public class SequenceComparator implements Comparator>, Serializable{ private static final long serialVersionUID = 1; diff --git a/biojava-core/src/main/java/org/biojava/nbio/core/sequence/edits/Edit.java b/biojava-core/src/main/java/org/biojava/nbio/core/sequence/edits/Edit.java index edf891c4f7..e0d06eb0c7 100644 --- a/biojava-core/src/main/java/org/biojava/nbio/core/sequence/edits/Edit.java +++ b/biojava-core/src/main/java/org/biojava/nbio/core/sequence/edits/Edit.java @@ -114,7 +114,7 @@ protected void setSequence(Sequence sequence) { * @param editingSequence Asked for in-case we need to do String to * Sequence conversion so we need a CompoundSet which is given * by the Sequence we are editing - * @return The Sequence object we wish to insert + * @return The {@link Sequence} object we wish to insert */ public Sequence getTargetSequence(Sequence editingSequence) { if (sequence == null && stringSequence != null) { diff --git a/biojava-core/src/main/java/org/biojava/nbio/core/sequence/features/AbstractFeature.java b/biojava-core/src/main/java/org/biojava/nbio/core/sequence/features/AbstractFeature.java index 16e894697c..5f0ed8043f 100644 --- a/biojava-core/src/main/java/org/biojava/nbio/core/sequence/features/AbstractFeature.java +++ b/biojava-core/src/main/java/org/biojava/nbio/core/sequence/features/AbstractFeature.java @@ -36,7 +36,7 @@ * A feature is currently any descriptive item that can be associated with a sequence position(s) * A feature has a type and a source which is currently a string to allow flexibility for the user * Ideally well defined features should have a class to describe attributes of that feature - * @author Scooter Willis + * @author Scooter Willis */ public abstract class AbstractFeature, C extends Compound> implements FeatureInterface { diff --git a/biojava-core/src/main/java/org/biojava/nbio/core/sequence/features/DBReferenceInfo.java b/biojava-core/src/main/java/org/biojava/nbio/core/sequence/features/DBReferenceInfo.java index 7598f77f33..3cc8b8897a 100644 --- a/biojava-core/src/main/java/org/biojava/nbio/core/sequence/features/DBReferenceInfo.java +++ b/biojava-core/src/main/java/org/biojava/nbio/core/sequence/features/DBReferenceInfo.java @@ -34,7 +34,7 @@ * Currently implement when the {@link UniprotProxySequenceReader} is used * to load a protein sequence * - * @author Scooter Willis + * @author Scooter Willis * @author Paolo Pavan */ public class DBReferenceInfo extends Qualifier { diff --git a/biojava-core/src/main/java/org/biojava/nbio/core/sequence/features/DatabaseReferenceInterface.java b/biojava-core/src/main/java/org/biojava/nbio/core/sequence/features/DatabaseReferenceInterface.java index 20c00034dd..a302d08857 100644 --- a/biojava-core/src/main/java/org/biojava/nbio/core/sequence/features/DatabaseReferenceInterface.java +++ b/biojava-core/src/main/java/org/biojava/nbio/core/sequence/features/DatabaseReferenceInterface.java @@ -30,7 +30,7 @@ /** * If a SequenceProxyReader implements this interface then that external source * has a list of cross reference id(s) - * @author Scooter Willis + * @author Scooter Willis */ public interface DatabaseReferenceInterface { diff --git a/biojava-core/src/main/java/org/biojava/nbio/core/sequence/features/FeatureDbReferenceInfo.java b/biojava-core/src/main/java/org/biojava/nbio/core/sequence/features/FeatureDbReferenceInfo.java index 3b49341d22..68b518b051 100644 --- a/biojava-core/src/main/java/org/biojava/nbio/core/sequence/features/FeatureDbReferenceInfo.java +++ b/biojava-core/src/main/java/org/biojava/nbio/core/sequence/features/FeatureDbReferenceInfo.java @@ -11,7 +11,7 @@ * Copyright for this code is held jointly by the individual * authors. These should be listed in @author doc comments. * - * @author Jacek Grzebyta + * @author Jacek Grzebyta <github:jgrzebyta> * * For more information on the BioJava project and its aims, * or to join the biojava-l mailing list, visit the home page diff --git a/biojava-core/src/main/java/org/biojava/nbio/core/sequence/features/FeatureInterface.java b/biojava-core/src/main/java/org/biojava/nbio/core/sequence/features/FeatureInterface.java index 47564bcefa..8976953fd0 100644 --- a/biojava-core/src/main/java/org/biojava/nbio/core/sequence/features/FeatureInterface.java +++ b/biojava-core/src/main/java/org/biojava/nbio/core/sequence/features/FeatureInterface.java @@ -33,11 +33,11 @@ * the surface of a protein where different sequence positions make up that feature. Ligand binding pocket is another example. * The location in its current form knows the start and stop position in a sequence and thus should contain knowledge about the * actual sequence. - * + *

* A feature can contain features to handle cases where a domain is a feature and the secondary structures covered by that domain * and other requirements for grouping. * - * @author Scooter Willis + * @author Scooter Willis * @author Paolo Pavan */ public interface FeatureInterface, C extends Compound> { @@ -46,32 +46,26 @@ public interface FeatureInterface, C extends Compo * Get the short description that can be used to describe the feature * @return */ - - public String getShortDescription(); + String getShortDescription(); /** * Set the short description that can be used to describe the feature * @param shortDescription */ + void setShortDescription(String shortDescription); - public void setShortDescription(String shortDescription); - - /** + /** * Get the description that can be used to describe the feature * @return */ + String getDescription(); - public String getDescription(); - - - /** + /** * Set the description that can be used to describe the feature - * @return */ + void setDescription(String description); - public void setDescription(String description); - - /** + /** * The location(s) of this feature where the location should contain a reference to parent and sequence etc. *

* The location may be complicated, or simply a range. @@ -80,7 +74,7 @@ public interface FeatureInterface, C extends Compo * * @return a Location anchoring this feature */ - public AbstractLocation getLocations(); + AbstractLocation getLocations(); /** * The new location for this feature. @@ -93,14 +87,14 @@ public interface FeatureInterface, C extends Compo * @param loc the new Location for this feature * */ - public void setLocation(AbstractLocation loc); + void setLocation(AbstractLocation loc); - /** + /** * The type of the feature. * * @return the type of this sequence */ - public String getType(); + String getType(); /** * Change the type of this feature. @@ -108,15 +102,15 @@ public interface FeatureInterface, C extends Compo * @param type new type String * */ - public void setType(String type); + void setType(String type); - /** + /** * The source of the feature. This may be a program or process. * * @return the source, or generator */ - public String getSource(); + String getSource(); /** * Change the source of the FeatureInterface. @@ -124,66 +118,60 @@ public interface FeatureInterface, C extends Compo * @param source the new source String * */ - public void setSource(String source); + void setSource(String source); /** * Set the parent feature * @param feature */ - - public void setParentFeature(FeatureInterface feature); + void setParentFeature(FeatureInterface feature); /** * Get the parent feature * @return */ - - public FeatureInterface getParentFeature(); + FeatureInterface getParentFeature(); /** * Get the features contained by this feature * @return */ - - public List> getChildrenFeatures(); + List> getChildrenFeatures(); /** * Set the children features * @param features */ + void setChildrenFeatures(List> features); - public void setChildrenFeatures(List> features); - - /** + /** * @return the userObject */ - public Object getUserObject(); + Object getUserObject(); /** * @param userObject the userObject to set */ - public void setUserObject(Object userObject); - + void setUserObject(Object userObject); /** * Get the qualifiers for this feature * @return */ - public Map> getQualifiers(); + Map> getQualifiers(); /** * Set the qualifiers * @param qualifiers */ + void setQualifiers(Map> qualifiers); - public void setQualifiers(Map> qualifiers); /** * Add a qualifier * @param qualifier */ - - public void addQualifier(String key, Qualifier qualifier); + void addQualifier(String key, Qualifier qualifier); } diff --git a/biojava-core/src/main/java/org/biojava/nbio/core/sequence/features/FeaturesKeyWordInterface.java b/biojava-core/src/main/java/org/biojava/nbio/core/sequence/features/FeaturesKeyWordInterface.java index 1b1acd994e..e7bef35d6c 100644 --- a/biojava-core/src/main/java/org/biojava/nbio/core/sequence/features/FeaturesKeyWordInterface.java +++ b/biojava-core/src/main/java/org/biojava/nbio/core/sequence/features/FeaturesKeyWordInterface.java @@ -28,7 +28,7 @@ * Models the keywords that are annotated for a protein sequence at Uniprot. If a ProxySequenceReader * implements this interface then the sequence will call this method * - * @author Scooter Willis + * @author Scooter Willis */ public interface FeaturesKeyWordInterface { diff --git a/biojava-core/src/main/java/org/biojava/nbio/core/sequence/features/QuantityFeature.java b/biojava-core/src/main/java/org/biojava/nbio/core/sequence/features/QuantityFeature.java index 524bdfdaa3..3e6304c5c6 100644 --- a/biojava-core/src/main/java/org/biojava/nbio/core/sequence/features/QuantityFeature.java +++ b/biojava-core/src/main/java/org/biojava/nbio/core/sequence/features/QuantityFeature.java @@ -31,7 +31,7 @@ * It is common to have a numerical value or values associated with a feature. This can then * be used in heat maps or other visual indicators when viewing a sequence. Multiple quantities * could represent a time corse study and display a color gradient - * @author Scooter Willis + * @author Scooter Willis */ public class QuantityFeature, C extends Compound> extends AbstractFeature { diff --git a/biojava-core/src/main/java/org/biojava/nbio/core/sequence/features/TextFeature.java b/biojava-core/src/main/java/org/biojava/nbio/core/sequence/features/TextFeature.java index 2b8cf26b59..5634e065a9 100644 --- a/biojava-core/src/main/java/org/biojava/nbio/core/sequence/features/TextFeature.java +++ b/biojava-core/src/main/java/org/biojava/nbio/core/sequence/features/TextFeature.java @@ -26,7 +26,7 @@ /** * A implmentation of AbstractFeature - * @author Scooter Willis + * @author Scooter Willis */ public class TextFeature, C extends Compound> extends AbstractFeature { diff --git a/biojava-core/src/main/java/org/biojava/nbio/core/sequence/io/ABITrace.java b/biojava-core/src/main/java/org/biojava/nbio/core/sequence/io/ABITrace.java index ea6f9abe1c..9561e21660 100644 --- a/biojava-core/src/main/java/org/biojava/nbio/core/sequence/io/ABITrace.java +++ b/biojava-core/src/main/java/org/biojava/nbio/core/sequence/io/ABITrace.java @@ -171,9 +171,9 @@ public int[] getQcalls() { } /** - * Returns the original programmatically determined (unedited) sequence as a AbstractSequence. + * Returns the original programmatically determined (unedited) sequence as a {@link AbstractSequence}. * - * @return AbstractSequence sequence + * @return sequence */ public AbstractSequence getSequence() throws CompoundNotFoundException { DNASequenceCreator creator = new DNASequenceCreator(ABITracerCompoundSet.getABITracerCompoundSet()); diff --git a/biojava-core/src/main/java/org/biojava/nbio/core/sequence/io/BufferedReaderBytesRead.java b/biojava-core/src/main/java/org/biojava/nbio/core/sequence/io/BufferedReaderBytesRead.java index 998bbada13..30aa52c5d7 100644 --- a/biojava-core/src/main/java/org/biojava/nbio/core/sequence/io/BufferedReaderBytesRead.java +++ b/biojava-core/src/main/java/org/biojava/nbio/core/sequence/io/BufferedReaderBytesRead.java @@ -174,7 +174,7 @@ private void fill() throws IOException { * Reads a single character. * * @return The character read, as an integer in the range - * 0 to 65535 (0x00-0xffff), or -1 if the + * 0 to 65535 (0x00-0xffff), or -1 if the * end of the stream has been reached * @exception IOException If an I/O error occurs */ @@ -521,7 +521,7 @@ public boolean markSupported() { * whose size is no smaller than limit. * Therefore large values should be used with care. * - * @exception IllegalArgumentException If readAheadLimit is < 0 + * @exception IllegalArgumentException If readAheadLimit is < 0 * @exception IOException If an I/O error occurs */ @Override diff --git a/biojava-core/src/main/java/org/biojava/nbio/core/sequence/io/CasePreservingProteinSequenceCreator.java b/biojava-core/src/main/java/org/biojava/nbio/core/sequence/io/CasePreservingProteinSequenceCreator.java index 94b2a6d918..0fb731ab10 100644 --- a/biojava-core/src/main/java/org/biojava/nbio/core/sequence/io/CasePreservingProteinSequenceCreator.java +++ b/biojava-core/src/main/java/org/biojava/nbio/core/sequence/io/CasePreservingProteinSequenceCreator.java @@ -41,14 +41,15 @@ *

The user collection will be the same length as the resulting ProteinSequence. * Each object can be cast to a Boolean. If true, the corresponding position in * the input file was uppercase. - * - *

Example

- *
CasePreservingProteinSequenceCreator creator =
+ * 

+ * Example + * + * CasePreservingProteinSequenceCreator creator = * new CasePreservingProteinSequenceCreator(AminoAcidCompoundSet.getAminoAcidCompoundSet()); - *AbstractSequence seq = creator.getSequence("aaAA",0); - *System.out.println(seq.getSequenceAsString()); //"AAAA" - *System.out.println(seq.getUserCollection()); //"[false, false, true, true]" - *

+ * AbstractSequence<AminoAcidCompound> seq = creator.getSequence("aaAA",0); + * System.out.println(seq.getSequenceAsString()); //"AAAA" + * System.out.println(seq.getUserCollection()); //"[false, false, true, true]" + *
*/ public class CasePreservingProteinSequenceCreator extends ProteinSequenceCreator { diff --git a/biojava-core/src/main/java/org/biojava/nbio/core/sequence/io/DNASequenceCreator.java b/biojava-core/src/main/java/org/biojava/nbio/core/sequence/io/DNASequenceCreator.java index 78a5dd4832..64a9467f3e 100644 --- a/biojava-core/src/main/java/org/biojava/nbio/core/sequence/io/DNASequenceCreator.java +++ b/biojava-core/src/main/java/org/biojava/nbio/core/sequence/io/DNASequenceCreator.java @@ -37,7 +37,7 @@ * A helper class that allows different ways to read a string and create a DNA sequence. Used in FastaReaderHelper * and probably a layer that isn't needed * - * @author Scooter Willis + * @author Scooter Willis */ public class DNASequenceCreator implements SequenceCreatorInterface { diff --git a/biojava-core/src/main/java/org/biojava/nbio/core/sequence/io/FastaGeneWriter.java b/biojava-core/src/main/java/org/biojava/nbio/core/sequence/io/FastaGeneWriter.java index 2297e5e070..065bfff79a 100644 --- a/biojava-core/src/main/java/org/biojava/nbio/core/sequence/io/FastaGeneWriter.java +++ b/biojava-core/src/main/java/org/biojava/nbio/core/sequence/io/FastaGeneWriter.java @@ -35,7 +35,7 @@ * A Gene sequence has a Positive or Negative Strand where we want to write out to a stream the 5 to 3 prime version. * It is also an option to write out the gene sequence where the exon regions are upper case * 6/22/2010 FastaWriter needs to be sequence aware to handle writing out a GeneSequence which is negative Strand with the proper sequence - * @author Scooter Willis + * @author Scooter Willis */ public class FastaGeneWriter { diff --git a/biojava-core/src/main/java/org/biojava/nbio/core/sequence/io/FastaReaderHelper.java b/biojava-core/src/main/java/org/biojava/nbio/core/sequence/io/FastaReaderHelper.java index 4493766202..973a2813c6 100644 --- a/biojava-core/src/main/java/org/biojava/nbio/core/sequence/io/FastaReaderHelper.java +++ b/biojava-core/src/main/java/org/biojava/nbio/core/sequence/io/FastaReaderHelper.java @@ -39,7 +39,7 @@ /** * - * @author Scooter Willis + * @author Scooter Willis */ public class FastaReaderHelper { diff --git a/biojava-core/src/main/java/org/biojava/nbio/core/sequence/io/FastaSequenceParser.java b/biojava-core/src/main/java/org/biojava/nbio/core/sequence/io/FastaSequenceParser.java index 35043c93bc..7140c094c5 100644 --- a/biojava-core/src/main/java/org/biojava/nbio/core/sequence/io/FastaSequenceParser.java +++ b/biojava-core/src/main/java/org/biojava/nbio/core/sequence/io/FastaSequenceParser.java @@ -28,7 +28,7 @@ /** * Used to parse a stream of a fasta file to get the sequence - * @author Scooter Willis + * @author Scooter Willis */ public class FastaSequenceParser implements SequenceParserInterface { diff --git a/biojava-core/src/main/java/org/biojava/nbio/core/sequence/io/FastaWriter.java b/biojava-core/src/main/java/org/biojava/nbio/core/sequence/io/FastaWriter.java index ff425bde49..f0fc191ff2 100644 --- a/biojava-core/src/main/java/org/biojava/nbio/core/sequence/io/FastaWriter.java +++ b/biojava-core/src/main/java/org/biojava/nbio/core/sequence/io/FastaWriter.java @@ -44,7 +44,7 @@ * and that is used when writing to the stream. This behavior can be overwritten by implementing * a custom FastaHeaderFormatInterface. * - * @author Scooter Willis + * @author Scooter Willis */ public class FastaWriter, C extends Compound> { diff --git a/biojava-core/src/main/java/org/biojava/nbio/core/sequence/io/FastaWriterHelper.java b/biojava-core/src/main/java/org/biojava/nbio/core/sequence/io/FastaWriterHelper.java index dfeae8a642..364260d9a2 100644 --- a/biojava-core/src/main/java/org/biojava/nbio/core/sequence/io/FastaWriterHelper.java +++ b/biojava-core/src/main/java/org/biojava/nbio/core/sequence/io/FastaWriterHelper.java @@ -39,7 +39,7 @@ /** * The class that should be used to write out fasta file of a sequence collection - * @author Scooter Willis + * @author Scooter Willis */ public class FastaWriterHelper { @@ -96,7 +96,7 @@ public static void writeGeneSequence(File file, Collection geneSeq /** * Write a collection of GeneSequences to a file where if the gene is negative strand it will flip and complement the sequence * @param outputStream - * @param dnaSequences + * @param geneSequences * @throws Exception */ diff --git a/biojava-core/src/main/java/org/biojava/nbio/core/sequence/io/FileProxyDNASequenceCreator.java b/biojava-core/src/main/java/org/biojava/nbio/core/sequence/io/FileProxyDNASequenceCreator.java index 21b0699ab6..96317cecdd 100644 --- a/biojava-core/src/main/java/org/biojava/nbio/core/sequence/io/FileProxyDNASequenceCreator.java +++ b/biojava-core/src/main/java/org/biojava/nbio/core/sequence/io/FileProxyDNASequenceCreator.java @@ -45,7 +45,7 @@ * Same approach can be used for genome sequence data stored in a local fasta file, in a database or via http * interface to a remote server * - * @author Scooter Willis + * @author Scooter Willis */ public class FileProxyDNASequenceCreator implements SequenceCreatorInterface { @@ -56,8 +56,9 @@ public class FileProxyDNASequenceCreator implements /** * Need File so that we can store full path name in SequenceFileProxyLoader for Random File access as a quick read - * @param fastaFile + * @param file * @param compoundSet + * @param sequenceParser */ public FileProxyDNASequenceCreator(File file, CompoundSet compoundSet, diff --git a/biojava-core/src/main/java/org/biojava/nbio/core/sequence/io/FileProxyProteinSequenceCreator.java b/biojava-core/src/main/java/org/biojava/nbio/core/sequence/io/FileProxyProteinSequenceCreator.java index e45907a2ed..f7e1cc7ab6 100644 --- a/biojava-core/src/main/java/org/biojava/nbio/core/sequence/io/FileProxyProteinSequenceCreator.java +++ b/biojava-core/src/main/java/org/biojava/nbio/core/sequence/io/FileProxyProteinSequenceCreator.java @@ -55,7 +55,7 @@ public class FileProxyProteinSequenceCreator implements SequenceCreatorInterface /** * Need File so that we can store full path name in SequenceFileProxyLoader for Random File access as a quick read - * @param fastaFile + * @param file * @param compoundSet */ public FileProxyProteinSequenceCreator(File file, CompoundSet compoundSet, SequenceParserInterface sequenceParser ) { diff --git a/biojava-core/src/main/java/org/biojava/nbio/core/sequence/io/FileProxyRNASequenceCreator.java b/biojava-core/src/main/java/org/biojava/nbio/core/sequence/io/FileProxyRNASequenceCreator.java index 58fe3f98d7..53de88bb06 100644 --- a/biojava-core/src/main/java/org/biojava/nbio/core/sequence/io/FileProxyRNASequenceCreator.java +++ b/biojava-core/src/main/java/org/biojava/nbio/core/sequence/io/FileProxyRNASequenceCreator.java @@ -45,7 +45,7 @@ * Same approach can be used for genome sequence data stored in a local fasta file, in a database or via http * interface to a remote server * - * @author Scooter Willis + * @author Scooter Willis */ public class FileProxyRNASequenceCreator implements SequenceCreatorInterface { @@ -56,7 +56,7 @@ public class FileProxyRNASequenceCreator implements /** * Need File so that we can store full path name in SequenceFileProxyLoader for Random File access as a quick read - * @param fastaFile + * @param file * @param compoundSet */ public FileProxyRNASequenceCreator(File file, diff --git a/biojava-core/src/main/java/org/biojava/nbio/core/sequence/io/GenbankReader.java b/biojava-core/src/main/java/org/biojava/nbio/core/sequence/io/GenbankReader.java index e2f4e8bf25..7f67918377 100644 --- a/biojava-core/src/main/java/org/biojava/nbio/core/sequence/io/GenbankReader.java +++ b/biojava-core/src/main/java/org/biojava/nbio/core/sequence/io/GenbankReader.java @@ -12,7 +12,7 @@ * authors. These should be listed in @author doc comments. * * @author Scooter Willis ;lt;willishf at gmail dot com> - * @author Karl Nicholas + * @author Karl Nicholas <github:karlnicholas> * @author Paolo Pavan * * For more information on the BioJava project and its aims, @@ -53,7 +53,8 @@ /** * Use {@link GenbankReaderHelper} as an example of how to use this class where {@link GenbankReaderHelper} should be the * primary class used to read Genbank files - * + * @param the sequence type + * @param the compound type */ public class GenbankReader, C extends Compound> { diff --git a/biojava-core/src/main/java/org/biojava/nbio/core/sequence/io/GenbankReaderHelper.java b/biojava-core/src/main/java/org/biojava/nbio/core/sequence/io/GenbankReaderHelper.java index 5146310591..7d382ce6b9 100644 --- a/biojava-core/src/main/java/org/biojava/nbio/core/sequence/io/GenbankReaderHelper.java +++ b/biojava-core/src/main/java/org/biojava/nbio/core/sequence/io/GenbankReaderHelper.java @@ -41,7 +41,7 @@ /** * - * @author Scooter Willis + * @author Scooter Willis */ public class GenbankReaderHelper { diff --git a/biojava-core/src/main/java/org/biojava/nbio/core/sequence/io/GenbankSequenceParser.java b/biojava-core/src/main/java/org/biojava/nbio/core/sequence/io/GenbankSequenceParser.java index 90653612e7..7b7f0e1450 100644 --- a/biojava-core/src/main/java/org/biojava/nbio/core/sequence/io/GenbankSequenceParser.java +++ b/biojava-core/src/main/java/org/biojava/nbio/core/sequence/io/GenbankSequenceParser.java @@ -17,7 +17,7 @@ * @author Bubba Puryear * @author George Waldon * @author Deepak Sheoran - * @author Karl Nicholas + * @author Karl Nicholas <github:karlnicholas> * @author Jacek Grzebyta * @author Paolo Pavan * diff --git a/biojava-core/src/main/java/org/biojava/nbio/core/sequence/io/GenbankWriter.java b/biojava-core/src/main/java/org/biojava/nbio/core/sequence/io/GenbankWriter.java index c99a9c23fd..9d47db3bbd 100644 --- a/biojava-core/src/main/java/org/biojava/nbio/core/sequence/io/GenbankWriter.java +++ b/biojava-core/src/main/java/org/biojava/nbio/core/sequence/io/GenbankWriter.java @@ -69,7 +69,6 @@ public GenbankWriter(OutputStream os, Collection sequences, * @param headerFormat * @param lineLength */ - public GenbankWriter(OutputStream os, Collection sequences, GenbankHeaderFormatInterface headerFormat, int lineLength) { this.os = os; @@ -82,9 +81,7 @@ public GenbankWriter(OutputStream os, Collection sequences, * Allow an override of operating system line separator for programs that * needs a specific CRLF or CR or LF option * - * @param lineSeparator */ - public void process() throws Exception { // Loosely based on code from Howard Salis // TODO - Force lower case? diff --git a/biojava-core/src/main/java/org/biojava/nbio/core/sequence/io/GenericFastaHeaderFormat.java b/biojava-core/src/main/java/org/biojava/nbio/core/sequence/io/GenericFastaHeaderFormat.java index a007af0a61..c26b8362da 100644 --- a/biojava-core/src/main/java/org/biojava/nbio/core/sequence/io/GenericFastaHeaderFormat.java +++ b/biojava-core/src/main/java/org/biojava/nbio/core/sequence/io/GenericFastaHeaderFormat.java @@ -32,7 +32,7 @@ * use the accession id. This allows the implementation by the user to write out complex header * with id notes etc without rewriting the fasta writer * - * @author Scooter Willis + * @author Scooter Willis */ public class GenericFastaHeaderFormat, C extends Compound> implements FastaHeaderFormatInterface { diff --git a/biojava-core/src/main/java/org/biojava/nbio/core/sequence/io/GenericFastaHeaderParser.java b/biojava-core/src/main/java/org/biojava/nbio/core/sequence/io/GenericFastaHeaderParser.java index 1556bf838e..f4c8ea3416 100644 --- a/biojava-core/src/main/java/org/biojava/nbio/core/sequence/io/GenericFastaHeaderParser.java +++ b/biojava-core/src/main/java/org/biojava/nbio/core/sequence/io/GenericFastaHeaderParser.java @@ -59,7 +59,7 @@ * NCBI Reference Sequence ref|accession|locus * Local Sequence identifier lcl|identifier * - * @author Scooter Willis + * @author Scooter Willis */ public class GenericFastaHeaderParser, C extends Compound> implements SequenceHeaderParserInterface { diff --git a/biojava-core/src/main/java/org/biojava/nbio/core/sequence/io/GenericGenbankHeaderParser.java b/biojava-core/src/main/java/org/biojava/nbio/core/sequence/io/GenericGenbankHeaderParser.java index 7b1dc0524d..4fd6354110 100644 --- a/biojava-core/src/main/java/org/biojava/nbio/core/sequence/io/GenericGenbankHeaderParser.java +++ b/biojava-core/src/main/java/org/biojava/nbio/core/sequence/io/GenericGenbankHeaderParser.java @@ -11,7 +11,7 @@ * Copyright for this code is held jointly by the individual * authors. These should be listed in @author doc comments. * - * @author Karl Nicholas + * @author Karl Nicholas <github:karlnicholas> * * For more information on the BioJava project and its aims, * or to join the biojava-l mailing list, visit the home page diff --git a/biojava-core/src/main/java/org/biojava/nbio/core/sequence/io/IUPACParser.java b/biojava-core/src/main/java/org/biojava/nbio/core/sequence/io/IUPACParser.java index 0f9b3ca950..65e9d96830 100644 --- a/biojava-core/src/main/java/org/biojava/nbio/core/sequence/io/IUPACParser.java +++ b/biojava-core/src/main/java/org/biojava/nbio/core/sequence/io/IUPACParser.java @@ -266,7 +266,7 @@ public boolean isStart(AminoAcidCompound compound) { * @param aminoAcids The target amino acid compounds objects */ @Override - public List getCodons(CompoundSet nucelotides, + public List getCodons(CompoundSet nucleotides, CompoundSet aminoAcids) { if (this.codons.isEmpty()) { @@ -277,9 +277,9 @@ public List getCodons(CompoundSet nucelotides, for (int i = 0; i < aminoAcidStrings.size(); i++) { List codonString = codonStrings.get(i); - NucleotideCompound one = getCompound(codonString, 0, nucelotides); - NucleotideCompound two = getCompound(codonString, 1, nucelotides); - NucleotideCompound three = getCompound(codonString, 2, nucelotides); + NucleotideCompound one = getCompound(codonString, 0, nucleotides); + NucleotideCompound two = getCompound(codonString, 1, nucleotides); + NucleotideCompound three = getCompound(codonString, 2, nucleotides); boolean start = ("M".equals(startCodonStrings.get(i))); boolean stop = ("*".equals(aminoAcidStrings.get(i))); AminoAcidCompound aminoAcid = aminoAcids diff --git a/biojava-core/src/main/java/org/biojava/nbio/core/sequence/io/ProteinSequenceCreator.java b/biojava-core/src/main/java/org/biojava/nbio/core/sequence/io/ProteinSequenceCreator.java index 1efebed609..6f4e839ca7 100644 --- a/biojava-core/src/main/java/org/biojava/nbio/core/sequence/io/ProteinSequenceCreator.java +++ b/biojava-core/src/main/java/org/biojava/nbio/core/sequence/io/ProteinSequenceCreator.java @@ -37,7 +37,7 @@ * Used to create a ProteinSequence from a String to allow for details * about the location of the sequence etc. * - * @author Scooter Willis + * @author Scooter Willis */ public class ProteinSequenceCreator implements SequenceCreatorInterface { diff --git a/biojava-core/src/main/java/org/biojava/nbio/core/sequence/io/RNASequenceCreator.java b/biojava-core/src/main/java/org/biojava/nbio/core/sequence/io/RNASequenceCreator.java index 0a691f1afa..16f69cbf74 100644 --- a/biojava-core/src/main/java/org/biojava/nbio/core/sequence/io/RNASequenceCreator.java +++ b/biojava-core/src/main/java/org/biojava/nbio/core/sequence/io/RNASequenceCreator.java @@ -35,7 +35,7 @@ /** * Used to create a RNA sequence * - * @author Scooter Willis + * @author Scooter Willis */ public class RNASequenceCreator implements SequenceCreatorInterface { diff --git a/biojava-core/src/main/java/org/biojava/nbio/core/sequence/io/embl/EmblRecord.java b/biojava-core/src/main/java/org/biojava/nbio/core/sequence/io/embl/EmblRecord.java index 1e84382b54..46497b5a0d 100644 --- a/biojava-core/src/main/java/org/biojava/nbio/core/sequence/io/embl/EmblRecord.java +++ b/biojava-core/src/main/java/org/biojava/nbio/core/sequence/io/embl/EmblRecord.java @@ -64,7 +64,7 @@ public class EmblRecord { * 6. Taxonomic division * 7. Sequence length * - * @return EmblId + * @return */ public EmblId getEmblId() { return emblId; @@ -80,7 +80,7 @@ public void setEmblId(EmblId emblId) { * The citations provide access to the papers from which the data has been * abstracted. * - * @return EmblReference + * @return */ public List getEmblReference() { return emblReference; @@ -94,7 +94,7 @@ public void setEmblReference(List emblReference) { * The AC (Accession number) line lists the accession numbers associated with * the entry. * - * @return List + * @return */ public List getAccessionNumber() { return accessionNumber; @@ -119,7 +119,7 @@ public void setProjectIdentifier(String projectIdentifier) { * The OG (OrGanelle) linetype indicates the sub-cellular location of non-nuclear * sequences. * - * @return String + * @return */ public String getOrGanelle() { return orGanelle; @@ -132,7 +132,7 @@ public void setOrGanelle(String orGanelle) { /** * The DT line shows when an entry first appeared in the database * - * @return String + * @return */ public String getCreatedDate() { return createdDate; @@ -146,7 +146,7 @@ public void setCreatedDate(String createdDate) { * The FH (Feature Header) lines are present only to improve readability of * an entry when it is printed or displayed on a terminal screen. * - * @return String + * @return */ public String getFeatureHeader() { return featureHeader; @@ -161,7 +161,7 @@ public void setFeatureHeader(String featureHeader) { * sequence data. Regions or sites in the sequence which are of interest are * listed in the table. * - * @return String + * @return */ public String getFeatureTable() { return featureTable; @@ -190,7 +190,7 @@ public void setLastUpdatedDate(String lastUpdatedDate) { * sequence codes, the region of the genome from which it is derived, or other * information which helps to identify the sequence. * - * @return String + * @return */ public String getSequenceDescription() { return sequenceDescription; @@ -205,7 +205,7 @@ public void setSequenceDescription(String sequenceDescription) { * cross-reference indexes of the sequence entries based on functional, * structural, or other categories deemed important. * - * @return List + * @return */ public List getKeyword() { return keyword; @@ -235,7 +235,7 @@ public void setOrganismSpecies(String organismSpecies) { * The OC (Organism Classification) lines contain the taxonomic classification * Of the source organism * - * @return String + * @return */ public String getOrganismClassification() { return organismClassification; @@ -249,7 +249,7 @@ public void setOrganismClassification(String organismClassification) { * The DR (Database Cross-reference) line cross-references other databases which * contain information related to the entry in which the DR line appears. * - * @return String + * @return */ public String getDatabaseCrossReference() { return databaseCrossReference; @@ -262,7 +262,7 @@ public void setDatabaseCrossReference(String databaseCrossReference) { /** * The AH (Assembly Header) line provides column headings for the assembly information. * - * @return String + * @return */ public String getAssemblyHeader() { return assemblyHeader; @@ -290,7 +290,7 @@ public void setAssemblyInformation(String assemblyInformation) { * Con(structed) sequences in the CON data classes represent complete * chromosomes, genomes and other long sequences constructed from segment entries. * - * @return String + * @return */ public String getConstructedSequence() { return constructedSequence; @@ -304,7 +304,7 @@ public void setConstructedSequence(String constructedSequence) { * The SQ (SeQuence header) line marks the beginning of the sequence data and * Gives a summary of its content. * - * @return String + * @return */ public String getSequenceHeader() { return sequenceHeader; @@ -317,7 +317,7 @@ public void setSequenceHeader(String sequenceHeader) { /** * The Sequence Data Line * - * @return String + * @return */ public String getSequence() { return sequence; diff --git a/biojava-core/src/main/java/org/biojava/nbio/core/sequence/io/template/FastaHeaderFormatInterface.java b/biojava-core/src/main/java/org/biojava/nbio/core/sequence/io/template/FastaHeaderFormatInterface.java index a0bb6af6d3..bfd3092357 100644 --- a/biojava-core/src/main/java/org/biojava/nbio/core/sequence/io/template/FastaHeaderFormatInterface.java +++ b/biojava-core/src/main/java/org/biojava/nbio/core/sequence/io/template/FastaHeaderFormatInterface.java @@ -27,13 +27,16 @@ /** * - * @author Scooter Willis + * @author Scooter Willis + * @param the compound type + * @param the sequence type */ public interface FastaHeaderFormatInterface, C extends Compound> { + /** * * @param sequence * @return */ - public String getHeader(S sequence); + String getHeader(S sequence); } diff --git a/biojava-core/src/main/java/org/biojava/nbio/core/sequence/io/template/GenbankHeaderFormatInterface.java b/biojava-core/src/main/java/org/biojava/nbio/core/sequence/io/template/GenbankHeaderFormatInterface.java index 5e08a424bf..0dff2d40eb 100644 --- a/biojava-core/src/main/java/org/biojava/nbio/core/sequence/io/template/GenbankHeaderFormatInterface.java +++ b/biojava-core/src/main/java/org/biojava/nbio/core/sequence/io/template/GenbankHeaderFormatInterface.java @@ -28,16 +28,18 @@ /** * @author mckeee1 - * + * @param the compound type + * @param the sequence type */ public interface GenbankHeaderFormatInterface, C extends Compound> { + + public static final String UNKNOWN_DNA = "UNK"; + /** * * @param sequence * @return */ - public static final String UNKNOWN_DNA = "UNK"; - - public String getHeader(S sequence); + String getHeader(S sequence); } diff --git a/biojava-core/src/main/java/org/biojava/nbio/core/sequence/io/template/SequenceCreatorInterface.java b/biojava-core/src/main/java/org/biojava/nbio/core/sequence/io/template/SequenceCreatorInterface.java index 9ec26dc225..c03900055b 100644 --- a/biojava-core/src/main/java/org/biojava/nbio/core/sequence/io/template/SequenceCreatorInterface.java +++ b/biojava-core/src/main/java/org/biojava/nbio/core/sequence/io/template/SequenceCreatorInterface.java @@ -32,7 +32,8 @@ /** * - * @author Scooter Willis + * @author Scooter Willis + * @param the compound type */ public interface SequenceCreatorInterface { /** diff --git a/biojava-core/src/main/java/org/biojava/nbio/core/sequence/io/template/SequenceHeaderParserInterface.java b/biojava-core/src/main/java/org/biojava/nbio/core/sequence/io/template/SequenceHeaderParserInterface.java index dba9d7ca3d..a49e27c754 100644 --- a/biojava-core/src/main/java/org/biojava/nbio/core/sequence/io/template/SequenceHeaderParserInterface.java +++ b/biojava-core/src/main/java/org/biojava/nbio/core/sequence/io/template/SequenceHeaderParserInterface.java @@ -27,7 +27,9 @@ /** * - * @author Scooter Willis + * @author Scooter Willis + * @param the compound type + * @param the sequence type */ public interface SequenceHeaderParserInterface, C extends Compound> { /** diff --git a/biojava-core/src/main/java/org/biojava/nbio/core/sequence/io/template/SequenceParserInterface.java b/biojava-core/src/main/java/org/biojava/nbio/core/sequence/io/template/SequenceParserInterface.java index fd536e2802..82b2cab38b 100644 --- a/biojava-core/src/main/java/org/biojava/nbio/core/sequence/io/template/SequenceParserInterface.java +++ b/biojava-core/src/main/java/org/biojava/nbio/core/sequence/io/template/SequenceParserInterface.java @@ -27,15 +27,15 @@ /** * - * @author Scooter Willis + * @author Scooter Willis */ public interface SequenceParserInterface { /** * - * @param dataInput + * @param bufferedReader * @param sequenceLength * @return - * @throws Exception + * @throws IOException */ - public String getSequence(BufferedReader bufferedReader,int sequenceLength) throws IOException; + String getSequence(BufferedReader bufferedReader,int sequenceLength) throws IOException; } diff --git a/biojava-core/src/main/java/org/biojava/nbio/core/sequence/io/util/IOUtils.java b/biojava-core/src/main/java/org/biojava/nbio/core/sequence/io/util/IOUtils.java index b60bc9eb00..fe3dfcd42a 100644 --- a/biojava-core/src/main/java/org/biojava/nbio/core/sequence/io/util/IOUtils.java +++ b/biojava-core/src/main/java/org/biojava/nbio/core/sequence/io/util/IOUtils.java @@ -157,7 +157,7 @@ public static List getList(File file) throws IOException { * * @param file File which may or may not be GZipped * @return The final stream - * @throws IOExceptio n + * @throws IOException */ public static InputStream openFile(File file) throws IOException { final InputStream is; @@ -178,7 +178,7 @@ public static InputStream openFile(File file) throws IOException { /** * Closure interface used when working with - * {@link IOUtils#processReader(String)}. Each time a line is encountered + * {@link IOUtils#processReader(BufferedReader, ReaderProcessor)}. Each time a line is encountered * the object that implements this interface will be invoked. * * @author ayates diff --git a/biojava-core/src/main/java/org/biojava/nbio/core/sequence/loader/GenbankProxySequenceReader.java b/biojava-core/src/main/java/org/biojava/nbio/core/sequence/loader/GenbankProxySequenceReader.java index d3e6c52661..f443472aad 100644 --- a/biojava-core/src/main/java/org/biojava/nbio/core/sequence/loader/GenbankProxySequenceReader.java +++ b/biojava-core/src/main/java/org/biojava/nbio/core/sequence/loader/GenbankProxySequenceReader.java @@ -11,7 +11,7 @@ * Copyright for this code is held jointly by the individual * authors. These should be listed in @author doc comments. * - * @author Karl Nicholas + * @author Karl Nicholas <github:karlnicholas> * * For more information on the BioJava project and its aims, * or to join the biojava-l mailing list, visit the home page @@ -42,8 +42,8 @@ import java.util.Map; /** - * @author Karl Nicholas - * @author Jacek Grzebyta + * @author Karl Nicholas <github:karlnicholas> + * @author Jacek Grzebyta <github:jgrzebyta> */ public class GenbankProxySequenceReader extends StringProxySequenceReader implements FeaturesKeyWordInterface, DatabaseReferenceInterface, FeatureRetriever { diff --git a/biojava-core/src/main/java/org/biojava/nbio/core/sequence/loader/SequenceFileProxyLoader.java b/biojava-core/src/main/java/org/biojava/nbio/core/sequence/loader/SequenceFileProxyLoader.java index 61df84f46d..ef4bf016cb 100644 --- a/biojava-core/src/main/java/org/biojava/nbio/core/sequence/loader/SequenceFileProxyLoader.java +++ b/biojava-core/src/main/java/org/biojava/nbio/core/sequence/loader/SequenceFileProxyLoader.java @@ -50,8 +50,8 @@ * data was loaded and then after X amount of time clear the contents to free up memory. * * - * @author Scooter Willis - * @param + * @author Scooter Willis + * @param the compound type */ public class SequenceFileProxyLoader implements ProxySequenceReader { diff --git a/biojava-core/src/main/java/org/biojava/nbio/core/sequence/loader/StringProxySequenceReader.java b/biojava-core/src/main/java/org/biojava/nbio/core/sequence/loader/StringProxySequenceReader.java index b97ad43bb9..86323d1289 100644 --- a/biojava-core/src/main/java/org/biojava/nbio/core/sequence/loader/StringProxySequenceReader.java +++ b/biojava-core/src/main/java/org/biojava/nbio/core/sequence/loader/StringProxySequenceReader.java @@ -38,10 +38,9 @@ /** * An example of a ProxySequenceReader that is created from a String. Used for testing - * @author Scooter Willis - * @param + * @author Scooter Willis + * @param the compound type */ - public class StringProxySequenceReader implements ProxySequenceReader { private String sequence; diff --git a/biojava-core/src/main/java/org/biojava/nbio/core/sequence/loader/UniprotProxySequenceReader.java b/biojava-core/src/main/java/org/biojava/nbio/core/sequence/loader/UniprotProxySequenceReader.java index f1cd7a7471..38feabdbf5 100644 --- a/biojava-core/src/main/java/org/biojava/nbio/core/sequence/loader/UniprotProxySequenceReader.java +++ b/biojava-core/src/main/java/org/biojava/nbio/core/sequence/loader/UniprotProxySequenceReader.java @@ -120,7 +120,6 @@ public UniprotProxySequenceReader(Document document, CompoundSet compoundSet) * @param xml * @param compoundSet * @return UniprotProxySequenceReader - * @throws Exception */ public static UniprotProxySequenceReader parseUniprotXMLString(String xml, CompoundSet compoundSet) { try { diff --git a/biojava-core/src/main/java/org/biojava/nbio/core/sequence/location/InsdcParser.java b/biojava-core/src/main/java/org/biojava/nbio/core/sequence/location/InsdcParser.java index e49bd22216..2d43a481bf 100644 --- a/biojava-core/src/main/java/org/biojava/nbio/core/sequence/location/InsdcParser.java +++ b/biojava-core/src/main/java/org/biojava/nbio/core/sequence/location/InsdcParser.java @@ -260,7 +260,9 @@ private List parseLocationString(String string, int versus) { l.setPartialOn3prime(true); } - if (!(accession == null || "".equals(accession))) l.setAccession(new AccessionID(accession)); + if (accession != null && !"".equals(accession)) { + l.setAccession(new AccessionID(accession)); + } boundedLocationsCollection.add(l); diff --git a/biojava-core/src/main/java/org/biojava/nbio/core/sequence/location/LocationHelper.java b/biojava-core/src/main/java/org/biojava/nbio/core/sequence/location/LocationHelper.java index d36d882c98..38f96d7d08 100644 --- a/biojava-core/src/main/java/org/biojava/nbio/core/sequence/location/LocationHelper.java +++ b/biojava-core/src/main/java/org/biojava/nbio/core/sequence/location/LocationHelper.java @@ -113,7 +113,7 @@ public static Location location(int start, int end, Strand strand, int length) { * other location builder this allows you to express your input * location on the reverse strand * - * @param location The location which currently expresses the outer + * @param start The location which currently expresses the outer * bounds of a circular location. * @param length The length of the circular genomic unit * @return The circular location; can optionally return a normal non @@ -307,7 +307,7 @@ public static Strand detectStrand(List subLocations) { } /** - * Assumes that the first element is the start & clones it + * Assumes that the first element is the start & clones it */ public static Point detectStart(List subLocations) { return subLocations.get(0).getStart().clonePoint(); diff --git a/biojava-core/src/main/java/org/biojava/nbio/core/sequence/location/SequenceLocation.java b/biojava-core/src/main/java/org/biojava/nbio/core/sequence/location/SequenceLocation.java index 443f7d9f06..beb03e3be7 100644 --- a/biojava-core/src/main/java/org/biojava/nbio/core/sequence/location/SequenceLocation.java +++ b/biojava-core/src/main/java/org/biojava/nbio/core/sequence/location/SequenceLocation.java @@ -31,7 +31,7 @@ import java.util.List; /** * A location in a sequence that keeps a reference to its parent sequence - * @author Scooter Willis + * @author Scooter Willis * @author Paolo Pavan */ public class SequenceLocation, C extends Compound> extends SimpleLocation { diff --git a/biojava-core/src/main/java/org/biojava/nbio/core/sequence/location/template/Location.java b/biojava-core/src/main/java/org/biojava/nbio/core/sequence/location/template/Location.java index b0887bf706..266f9a6f1b 100644 --- a/biojava-core/src/main/java/org/biojava/nbio/core/sequence/location/template/Location.java +++ b/biojava-core/src/main/java/org/biojava/nbio/core/sequence/location/template/Location.java @@ -71,7 +71,7 @@ public interface Location extends Iterable, Accessioned { /** * Gives access to the sub locations for this location. However this does * not return sub-locations of sub-locations. For that functionality use - * {@link #getAllSubLocations()}. + * {@link #getRelevantSubLocations()}. * * @return A list of a single level of sub-locations */ @@ -107,7 +107,7 @@ public interface Location extends Iterable, Accessioned { * Will return a SequenceReader object which represents the outer bounds * of this Location * - * @param <C> The type of compound to use + * @param The type of compound to use * @param sequence The sequence object to work with * @return The sequence */ @@ -118,7 +118,7 @@ public interface Location extends Iterable, Accessioned { * locations i.e. those locations which are not complex and define the * true Sequence represented * - * @param <C> The type of compound to use + * @param The type of compound to use * @param sequence The sequence object to work with * @return The full assembled sequence */ @@ -166,7 +166,7 @@ public static Location location(int start, int end, Strand strand, int length) { * other location builder this allows you to express your input * location on the reverse strand * - * @param location The location which currently expresses the outer + * @param start The location which currently expresses the outer * bounds of a circular location. * @param length The length of the circular genomic unit * @return The circular location; can optionally return a normal non diff --git a/biojava-core/src/main/java/org/biojava/nbio/core/sequence/reference/AbstractReference.java b/biojava-core/src/main/java/org/biojava/nbio/core/sequence/reference/AbstractReference.java index 64c9792a0b..3c9958cb5c 100644 --- a/biojava-core/src/main/java/org/biojava/nbio/core/sequence/reference/AbstractReference.java +++ b/biojava-core/src/main/java/org/biojava/nbio/core/sequence/reference/AbstractReference.java @@ -22,7 +22,7 @@ /** * @since 5.0.0 - * @Author Jim Tang + * @author Jim Tang */ public abstract class AbstractReference implements ReferenceInterface { diff --git a/biojava-core/src/main/java/org/biojava/nbio/core/sequence/reference/GenbankReference.java b/biojava-core/src/main/java/org/biojava/nbio/core/sequence/reference/GenbankReference.java index 9e67dcb0fa..ff8db13727 100644 --- a/biojava-core/src/main/java/org/biojava/nbio/core/sequence/reference/GenbankReference.java +++ b/biojava-core/src/main/java/org/biojava/nbio/core/sequence/reference/GenbankReference.java @@ -24,7 +24,7 @@ * For Genbank format file only. * * @since 5.0.0 - * @Author Jim Tang + * @author Jim Tang */ public class GenbankReference extends AbstractReference { diff --git a/biojava-core/src/main/java/org/biojava/nbio/core/sequence/reference/ReferenceInterface.java b/biojava-core/src/main/java/org/biojava/nbio/core/sequence/reference/ReferenceInterface.java index 2c3b8fa457..6c86cca96d 100644 --- a/biojava-core/src/main/java/org/biojava/nbio/core/sequence/reference/ReferenceInterface.java +++ b/biojava-core/src/main/java/org/biojava/nbio/core/sequence/reference/ReferenceInterface.java @@ -22,7 +22,7 @@ /** * @since 5.0.0 - * @Author Jim Tang + * @author Jim Tang */ public interface ReferenceInterface { diff --git a/biojava-core/src/main/java/org/biojava/nbio/core/sequence/storage/ArrayListSequenceReader.java b/biojava-core/src/main/java/org/biojava/nbio/core/sequence/storage/ArrayListSequenceReader.java index 5e499261c1..1cfc068fbb 100644 --- a/biojava-core/src/main/java/org/biojava/nbio/core/sequence/storage/ArrayListSequenceReader.java +++ b/biojava-core/src/main/java/org/biojava/nbio/core/sequence/storage/ArrayListSequenceReader.java @@ -39,7 +39,7 @@ /** * Stores a Sequence as a collection of compounds in an ArrayList * - * @param + * @param the compound type */ public class ArrayListSequenceReader implements SequenceReader { diff --git a/biojava-core/src/main/java/org/biojava/nbio/core/sequence/storage/BitSequenceReader.java b/biojava-core/src/main/java/org/biojava/nbio/core/sequence/storage/BitSequenceReader.java index 4c1f064ea6..8ca85aeec3 100644 --- a/biojava-core/src/main/java/org/biojava/nbio/core/sequence/storage/BitSequenceReader.java +++ b/biojava-core/src/main/java/org/biojava/nbio/core/sequence/storage/BitSequenceReader.java @@ -64,7 +64,7 @@ public BitSequenceReader(BitArrayWorker worker, AccessionID accession) { } /** - * Class is immutable & so this is unsupported + * Class is immutable, so this is unsupported */ @Override public void setCompoundSet(CompoundSet compoundSet) { @@ -72,7 +72,7 @@ public void setCompoundSet(CompoundSet compoundSet) { } /** - * Class is immutable & so this is unsupported + * Class is immutable, so this is unsupported */ @Override public void setContents(String sequence) throws CompoundNotFoundException { diff --git a/biojava-core/src/main/java/org/biojava/nbio/core/sequence/storage/JoiningSequenceReader.java b/biojava-core/src/main/java/org/biojava/nbio/core/sequence/storage/JoiningSequenceReader.java index 46a0501b8a..ae1471b52c 100644 --- a/biojava-core/src/main/java/org/biojava/nbio/core/sequence/storage/JoiningSequenceReader.java +++ b/biojava-core/src/main/java/org/biojava/nbio/core/sequence/storage/JoiningSequenceReader.java @@ -56,7 +56,7 @@ public class JoiningSequenceReader implements ProxySequenceR private int[] minSequenceIndex; /** - * Allows creation of the store from Vargs Sequence objects. CompoundSet + * Allows creation of the store from Vargs {@link Sequence} objects. CompoundSet * defaults to the first element of the array (assuming there are elements * available during construction otherwise we will throw an illegal * state exception). @@ -66,7 +66,7 @@ public JoiningSequenceReader(Sequence... sequences) { } /** - * Allows creation of the store from List>. CompoundSet + * Allows creation of the store from {@link List>}. CompoundSet * defaults to the first element of the List (assuming there are elements * available during construction otherwise we will throw an illegal * state exception). @@ -217,7 +217,7 @@ else if (midMinPosition > position && midMaxPosition > position) { /** * Iterator implementation which attempts to move through the 2D structure - * attempting to skip onto the next sequence as & when it is asked to + * attempting to skip onto the next sequence as & when it is asked to */ @Override diff --git a/biojava-core/src/main/java/org/biojava/nbio/core/sequence/storage/SequenceAsStringHelper.java b/biojava-core/src/main/java/org/biojava/nbio/core/sequence/storage/SequenceAsStringHelper.java index 995a358ef0..4acd8969f1 100644 --- a/biojava-core/src/main/java/org/biojava/nbio/core/sequence/storage/SequenceAsStringHelper.java +++ b/biojava-core/src/main/java/org/biojava/nbio/core/sequence/storage/SequenceAsStringHelper.java @@ -29,7 +29,7 @@ /** * This is a common method that can be used across multiple storage/proxy implementations to * handle Negative strand and other interesting elements of sequence data. - * @author Scooter Willis + * @author Scooter Willis */ public class SequenceAsStringHelper { @@ -44,7 +44,7 @@ public class SequenceAsStringHelper { */ public String getSequenceAsString(List parsedCompounds, CompoundSet compoundSet, Integer bioBegin, Integer bioEnd, Strand strand) { // TODO Optimise/cache. - if(parsedCompounds.size() == 0) + if(parsedCompounds.isEmpty()) return ""; StringBuilder builder = new StringBuilder(); if (strand.equals(Strand.NEGATIVE)) { diff --git a/biojava-core/src/main/java/org/biojava/nbio/core/sequence/storage/SingleCompoundSequenceReader.java b/biojava-core/src/main/java/org/biojava/nbio/core/sequence/storage/SingleCompoundSequenceReader.java index b02c1e0c77..fd492f1bf9 100644 --- a/biojava-core/src/main/java/org/biojava/nbio/core/sequence/storage/SingleCompoundSequenceReader.java +++ b/biojava-core/src/main/java/org/biojava/nbio/core/sequence/storage/SingleCompoundSequenceReader.java @@ -168,7 +168,7 @@ public AccessionID getAccession() { } /** - * Delegates to {@link SequenceMixin#countCompounds(org.biojava.nbio.core.sequence.template.Sequence, C[]) } + * Delegates to {@link SequenceMixin#countCompounds} */ @Override diff --git a/biojava-core/src/main/java/org/biojava/nbio/core/sequence/template/AbstractSequence.java b/biojava-core/src/main/java/org/biojava/nbio/core/sequence/template/AbstractSequence.java index b5b2d29740..38cf55d09c 100644 --- a/biojava-core/src/main/java/org/biojava/nbio/core/sequence/template/AbstractSequence.java +++ b/biojava-core/src/main/java/org/biojava/nbio/core/sequence/template/AbstractSequence.java @@ -47,7 +47,7 @@ /** * * The base class for DNA, RNA and Protein sequences. - * @param + * @param the compound type */ public abstract class AbstractSequence implements Sequence { diff --git a/biojava-core/src/main/java/org/biojava/nbio/core/sequence/template/Compound.java b/biojava-core/src/main/java/org/biojava/nbio/core/sequence/template/Compound.java index 6dbeda2208..aa04cb8c8a 100644 --- a/biojava-core/src/main/java/org/biojava/nbio/core/sequence/template/Compound.java +++ b/biojava-core/src/main/java/org/biojava/nbio/core/sequence/template/Compound.java @@ -28,21 +28,23 @@ public interface Compound { - public boolean equalsIgnoreCase(Compound compound); + boolean equalsIgnoreCase(Compound compound); - public String getDescription(); + String getDescription(); - public void setDescription(String description); + void setDescription(String description); - public String getShortName(); + String getShortName(); - public void setShortName(String shortName); + void setShortName(String shortName); - public String getLongName(); + String getLongName(); - public void setLongName(String longName); + void setLongName(String longName); - public Float getMolecularWeight(); + Float getMolecularWeight(); - public void setMolecularWeight(Float molecularWeight); + void setMolecularWeight(Float molecularWeight); + + String toString(); } diff --git a/biojava-core/src/main/java/org/biojava/nbio/core/sequence/template/LightweightProfile.java b/biojava-core/src/main/java/org/biojava/nbio/core/sequence/template/LightweightProfile.java index e6f632224b..033fa84e85 100644 --- a/biojava-core/src/main/java/org/biojava/nbio/core/sequence/template/LightweightProfile.java +++ b/biojava-core/src/main/java/org/biojava/nbio/core/sequence/template/LightweightProfile.java @@ -52,7 +52,7 @@ enum StringFormat { * * @param listIndex index of sequence in profile * @return desired sequence - * @throws IndexOutOfBoundsException if listIndex < 1 or listIndex > number of sequences + * @throws IndexOutOfBoundsException if listIndex < 1 or listIndex > number of sequences */ S getAlignedSequence(int listIndex); @@ -68,7 +68,7 @@ enum StringFormat { * * @param alignmentIndex column index within an alignment * @return the sequence elements - * @throws IndexOutOfBoundsException if alignmentIndex < 1 or alignmentIndex > {@link #getLength()} + * @throws IndexOutOfBoundsException if alignmentIndex < 1 or alignmentIndex > {@link #getLength()} */ List getCompoundsAt(int alignmentIndex); diff --git a/biojava-core/src/main/java/org/biojava/nbio/core/sequence/template/SequenceMixin.java b/biojava-core/src/main/java/org/biojava/nbio/core/sequence/template/SequenceMixin.java index c3dec3d0bd..a71c9ba6f8 100644 --- a/biojava-core/src/main/java/org/biojava/nbio/core/sequence/template/SequenceMixin.java +++ b/biojava-core/src/main/java/org/biojava/nbio/core/sequence/template/SequenceMixin.java @@ -150,7 +150,7 @@ public static Map getComposition(Sequence se * converting to a full length String and then writing the data out * * @param Type of compound - * @param writer The writer to send data to + * @param appendable The writer to send data to * @param sequence The sequence to write out * @throws IOException Thrown if we encounter a problem */ @@ -244,7 +244,7 @@ public static SequenceView createSubSequence( * Implements sequence shuffling by first materializing the given * {@link Sequence} into a {@link List}, applying * {@link Collections#shuffle(List)} and then returning the shuffled - * elements in a new instance of {@link SequenceBackingStore} which behaves + * elements in a new instance of {@link Sequence} which behaves * as a {@link Sequence}. */ public static Sequence shuffle(Sequence sequence) { @@ -285,7 +285,7 @@ public static List> nonOverlappingKmers(Seq /** * Used to generate overlapping k-mers such i.e. ATGTA will give rise to - * ATG, TGT & GTA + * ATG, TGT & GTA * * @param Compound to use * @param sequence Sequence to build from @@ -343,7 +343,7 @@ public static SequenceView inverse(Sequence sequence) /** * A case-insensitive manner of comparing two sequence objects together. * We will throw out any compounds which fail to match on their sequence - * length & compound sets used. The code will also bail out the moment + * length & compound sets used. The code will also bail out the moment * we find something is wrong with a Sequence. Cost to run is linear to * the length of the Sequence. * @@ -359,7 +359,7 @@ public static boolean sequenceEqualityIgnoreCase(Sequence getCodonCompoundSet( /** * Instance of a Codon which is 3 {@link NucleotideCompound}s, its * corresponding {@link AminoAcidCompound} and if it is a start or stop codon. - * The object implements hashCode & equals but according to the nucleotide - * compounds & not to the designation of it being a start, stop & amino + * The object implements hashCode & equals but according to the nucleotide + * compounds & not to the designation of it being a start, stop & amino * acid compound * * @author ayates diff --git a/biojava-core/src/main/java/org/biojava/nbio/core/sequence/transcription/TranscriptionEngine.java b/biojava-core/src/main/java/org/biojava/nbio/core/sequence/transcription/TranscriptionEngine.java index 162d760f05..f79bd0465e 100644 --- a/biojava-core/src/main/java/org/biojava/nbio/core/sequence/transcription/TranscriptionEngine.java +++ b/biojava-core/src/main/java/org/biojava/nbio/core/sequence/transcription/TranscriptionEngine.java @@ -39,7 +39,7 @@ * Protein sequence. * * In order to build one look at @ TranscriptionEngine.Builder} which provides - * intelligent defaults & allows you to build an engine which is nearly the same + * intelligent defaults and allows you to build an engine which is nearly the same * as the default one but with a few changes. All of the engine is customisable. * * By default the code will attempt to: @@ -48,7 +48,7 @@ *
  • Trim Stops
  • *
  • Convert initiating codons to M
  • *
  • Allow for the fuzzy translation of Codons i.e. if it contains an N that - * produces a {@link Sequence}<{@link{AminoAcidCompound}> with an X at + * produces a {@link Sequence} with an X at * that position * * @@ -170,7 +170,7 @@ public CompoundSet getAminoAcidCompounds() { } /** - * This class is the way to create a {@link TranslationEngine}. + * This class is the way to create a {@link TranscriptionEngine}. */ public static class Builder { diff --git a/biojava-core/src/main/java/org/biojava/nbio/core/util/Equals.java b/biojava-core/src/main/java/org/biojava/nbio/core/util/Equals.java index e8f78243ed..7e2c7128c9 100644 --- a/biojava-core/src/main/java/org/biojava/nbio/core/util/Equals.java +++ b/biojava-core/src/main/java/org/biojava/nbio/core/util/Equals.java @@ -49,7 +49,13 @@ public static boolean equal(boolean one, boolean two) { * @see #classEqual(Object, Object) */ public static boolean equal(Object one, Object two) { - return one == null && two == null || !(one == null || two == null) && (one == two || one.equals(two)); + if (one == two) { + return true; + } + if (one == null || two == null) { + return false; + } + return one.equals(two); } /** @@ -84,6 +90,12 @@ public static boolean equal(Object one, Object two) { * equal at the class level */ public static boolean classEqual(Object one, Object two) { - return one == two || !(one == null || two == null) && one.getClass() == two.getClass(); + if (one == two) { + return true; + } + if (one == null || two == null) { + return false; + } + return one.getClass() == two.getClass(); } } diff --git a/biojava-core/src/main/java/org/biojava/nbio/core/util/FileDownloadUtils.java b/biojava-core/src/main/java/org/biojava/nbio/core/util/FileDownloadUtils.java index 3259676ef0..0b132b180e 100644 --- a/biojava-core/src/main/java/org/biojava/nbio/core/util/FileDownloadUtils.java +++ b/biojava-core/src/main/java/org/biojava/nbio/core/util/FileDownloadUtils.java @@ -336,8 +336,8 @@ public static boolean ping(String url, int timeout) { * *

    * - * NB. User should execute connect() method before getting input - * stream. + * NB. User should execute connect() method before getting input + * stream. * @return * @throws IOException * @author Jacek Grzebyta @@ -350,7 +350,7 @@ public static URLConnection prepareURLConnection(String url, int timeout) throws } /** - * Recursively delete a folder & contents + * Recursively delete a folder & contents * * @param dir directory to delete */ @@ -375,7 +375,7 @@ public FileVisitResult postVisitDirectory(Path dir, IOException e) throws IOExce }); } /** - * Recursively delete a folder & contents + * Recursively delete a folder & contents * * @param dir directory to delete */ diff --git a/biojava-core/src/main/java/org/biojava/nbio/core/util/FlatFileCache.java b/biojava-core/src/main/java/org/biojava/nbio/core/util/FlatFileCache.java index 09f8a6760d..5df00ea661 100644 --- a/biojava-core/src/main/java/org/biojava/nbio/core/util/FlatFileCache.java +++ b/biojava-core/src/main/java/org/biojava/nbio/core/util/FlatFileCache.java @@ -58,7 +58,7 @@ private FlatFileCache(){ /** * The file is read and the bytes stored immediately. - *

    + *

    * Once added, {@code fileToCache} can be modified or deleted and the cached values will not change. * @param key * @param fileToCache A readable file, of Integer.MAX bytes length or less. @@ -123,7 +123,7 @@ public static InputStream getInputStream(String key){ /** * Returns the number of items in the cache. - * If the cache is {@}, returns -1 + * If the cache is empty, returns -1 * @return */ public static int size() { diff --git a/biojava-core/src/main/java/org/biojava/nbio/core/util/PrettyXMLWriter.java b/biojava-core/src/main/java/org/biojava/nbio/core/util/PrettyXMLWriter.java index 437085866f..6e4a7db77c 100644 --- a/biojava-core/src/main/java/org/biojava/nbio/core/util/PrettyXMLWriter.java +++ b/biojava-core/src/main/java/org/biojava/nbio/core/util/PrettyXMLWriter.java @@ -72,7 +72,7 @@ public void declareNamespace(String nsURI, String prefixHint) private void handleDeclaredNamespaces() throws IOException { - if (namespacesDeclared.size() == 0) { + if (namespacesDeclared.isEmpty()) { for (Iterator nsi = namespacesDeclared.iterator(); nsi.hasNext(); ) { String nsURI = nsi.next(); if (!namespacePrefixes.containsKey(nsURI)) { diff --git a/biojava-core/src/main/java/org/biojava/nbio/core/util/SoftHashMap.java b/biojava-core/src/main/java/org/biojava/nbio/core/util/SoftHashMap.java index f3bcef0468..2c10948b55 100644 --- a/biojava-core/src/main/java/org/biojava/nbio/core/util/SoftHashMap.java +++ b/biojava-core/src/main/java/org/biojava/nbio/core/util/SoftHashMap.java @@ -31,13 +31,16 @@ import org.slf4j.LoggerFactory; -/** A in memory cache using soft references. (can be garbage collected) +/** + * An in memory cache using soft references. (can be garbage collected) * This code is based on: http://java-interview-faqs.blogspot.com/2008/09/building-faster-and-efficient-cache.html - *

    + *

    * Note that entrySet() is not implemented and therefore many methods such as keySet(), * containsKey(), values() etc do not work. - *

    + *

    * This class is therefore best used as a cache simply to put and get items by a known key + * @param the key type + * @param the value type */ public class SoftHashMap extends AbstractMap { diff --git a/biojava-core/src/main/java/org/biojava/nbio/core/util/StringManipulationHelper.java b/biojava-core/src/main/java/org/biojava/nbio/core/util/StringManipulationHelper.java index 1fe985d0ba..1ddadf695c 100644 --- a/biojava-core/src/main/java/org/biojava/nbio/core/util/StringManipulationHelper.java +++ b/biojava-core/src/main/java/org/biojava/nbio/core/util/StringManipulationHelper.java @@ -77,7 +77,7 @@ private StringManipulationHelper() { *

  • Any IOException reading the stream is 'squashed' and not made * available to caller *
  • An additional newline is appended at the end of the string. - *
      + *
    * @author andreas * @param stream * @return a possibly empty but non-null String @@ -202,9 +202,9 @@ public static boolean equalsToXml(String expected, String actual) { /** * Adds padding to left of supplied string * @param s The String to pad - * @param n an integer >= 1 + * @param n an integer >= 1 * @return The left-padded string. - * @throws IllegalArgumentException if n <= 0 + * @throws IllegalArgumentException if n <= 0 */ public static String padLeft(String s, int n) { validatePadding(n); @@ -214,9 +214,9 @@ public static String padLeft(String s, int n) { /** * Adds padding to right of supplied string * @param s The String to pad - * @param n an integer >= 1 + * @param n an integer >= 1 * @return The right-padded string. - * @throws IllegalArgumentException if n <= 0 + * @throws IllegalArgumentException if n <= 0 */ public static String padRight(String s, int n) { validatePadding(n); diff --git a/biojava-core/src/main/java/org/biojava/nbio/core/util/XMLHelper.java b/biojava-core/src/main/java/org/biojava/nbio/core/util/XMLHelper.java index 64aee3849a..9b895ef492 100644 --- a/biojava-core/src/main/java/org/biojava/nbio/core/util/XMLHelper.java +++ b/biojava-core/src/main/java/org/biojava/nbio/core/util/XMLHelper.java @@ -164,7 +164,7 @@ public static Element selectParentElement(Element element, String parentName) { /** * If {@code}xpathExpression{@code} is a plain string with no '/' characterr, this is * interpreted as a child element name to search for. - * + *

    * If {@code}xpathExpression{@code} is an XPath expression, this is evaluated and is assumed * to identify a single element. * @param element diff --git a/biojava-core/src/main/java/org/biojava/nbio/core/util/XMLWriter.java b/biojava-core/src/main/java/org/biojava/nbio/core/util/XMLWriter.java index 141ddba640..7b799818df 100644 --- a/biojava-core/src/main/java/org/biojava/nbio/core/util/XMLWriter.java +++ b/biojava-core/src/main/java/org/biojava/nbio/core/util/XMLWriter.java @@ -113,7 +113,7 @@ public interface XMLWriter { * avoid namespaces that are used only in leaf-nodes of a tree being re-defined * every time they are used. The XMLWriter will generally try to use the * suggested prefix for this namespace, but there is no guarantee of this. - *

    + *

    * * In particular, if the namespace is already in use, the current prefix will still * be used. Similarly if the suggested prefix has already been used for another diff --git a/biojava-core/src/test/java/org/biojava/nbio/core/sequence/io/FastaReaderTest.java b/biojava-core/src/test/java/org/biojava/nbio/core/sequence/io/FastaReaderTest.java index 7981d8e6e3..466cabaa94 100644 --- a/biojava-core/src/test/java/org/biojava/nbio/core/sequence/io/FastaReaderTest.java +++ b/biojava-core/src/test/java/org/biojava/nbio/core/sequence/io/FastaReaderTest.java @@ -35,7 +35,7 @@ /** * - * @author Scooter Willis + * @author Scooter Willis */ public class FastaReaderTest { diff --git a/biojava-core/src/test/java/org/biojava/nbio/core/sequence/io/GenbankCookbookTest.java b/biojava-core/src/test/java/org/biojava/nbio/core/sequence/io/GenbankCookbookTest.java index 132a36d816..06459579a7 100644 --- a/biojava-core/src/test/java/org/biojava/nbio/core/sequence/io/GenbankCookbookTest.java +++ b/biojava-core/src/test/java/org/biojava/nbio/core/sequence/io/GenbankCookbookTest.java @@ -37,7 +37,7 @@ /** * - * @author Scooter Willis + * @author Scooter Willis */ public class GenbankCookbookTest { diff --git a/biojava-core/src/test/java/org/biojava/nbio/core/sequence/io/GenbankReaderTest.java b/biojava-core/src/test/java/org/biojava/nbio/core/sequence/io/GenbankReaderTest.java index e813f863a8..0a03c85586 100644 --- a/biojava-core/src/test/java/org/biojava/nbio/core/sequence/io/GenbankReaderTest.java +++ b/biojava-core/src/test/java/org/biojava/nbio/core/sequence/io/GenbankReaderTest.java @@ -43,7 +43,7 @@ /** * - * @author Scooter Willis + * @author Scooter Willis * @author Jacek Grzebyta * @author Philippe Soares */ diff --git a/biojava-core/src/test/java/org/biojava/nbio/core/sequence/io/GenericFastaHeaderParserTest.java b/biojava-core/src/test/java/org/biojava/nbio/core/sequence/io/GenericFastaHeaderParserTest.java index 4d8ae7e8bd..b5e5598722 100644 --- a/biojava-core/src/test/java/org/biojava/nbio/core/sequence/io/GenericFastaHeaderParserTest.java +++ b/biojava-core/src/test/java/org/biojava/nbio/core/sequence/io/GenericFastaHeaderParserTest.java @@ -32,7 +32,7 @@ /** * - * @author Scooter Willis + * @author Scooter Willis */ public class GenericFastaHeaderParserTest { @@ -52,7 +52,7 @@ public class GenericFastaHeaderParserTest { * NCBI Reference Sequence ref|accession|locus * Local Sequence identifier lcl|identifier * - * @author Scooter Willis + * @author Scooter Willis */ @Test public void testParseHeader() throws CompoundNotFoundException { diff --git a/biojava-core/src/test/java/org/biojava/nbio/core/sequence/loader/SimpleGenbankProxySequenceReaderTest.java b/biojava-core/src/test/java/org/biojava/nbio/core/sequence/loader/SimpleGenbankProxySequenceReaderTest.java index 4150e90ffc..072e25a1e4 100644 --- a/biojava-core/src/test/java/org/biojava/nbio/core/sequence/loader/SimpleGenbankProxySequenceReaderTest.java +++ b/biojava-core/src/test/java/org/biojava/nbio/core/sequence/loader/SimpleGenbankProxySequenceReaderTest.java @@ -34,7 +34,6 @@ * * @author Jacek Grzebyta * @author Paolo Pavan - * @see InfoTask */ public class SimpleGenbankProxySequenceReaderTest { diff --git a/biojava-genome/pom.xml b/biojava-genome/pom.xml index a61abf567a..68575bbb9b 100644 --- a/biojava-genome/pom.xml +++ b/biojava-genome/pom.xml @@ -3,7 +3,7 @@ biojava org.biojava - 7.1.2 + 7.2.5-SNAPSHOT 4.0.0 biojava-genome @@ -70,13 +70,13 @@ org.biojava biojava-core - 7.1.2 + 7.2.5-SNAPSHOT compile org.biojava biojava-alignment - 7.1.2 + 7.2.5-SNAPSHOT compile diff --git a/biojava-genome/src/main/java/org/biojava/nbio/genome/GeneFeatureHelper.java b/biojava-genome/src/main/java/org/biojava/nbio/genome/GeneFeatureHelper.java index 0090ce7786..c9786b3ad0 100644 --- a/biojava-genome/src/main/java/org/biojava/nbio/genome/GeneFeatureHelper.java +++ b/biojava-genome/src/main/java/org/biojava/nbio/genome/GeneFeatureHelper.java @@ -36,7 +36,7 @@ /** * - * @author Scooter Willis + * @author Scooter Willis */ public class GeneFeatureHelper { diff --git a/biojava-genome/src/main/java/org/biojava/nbio/genome/homology/BlastHomologyHits.java b/biojava-genome/src/main/java/org/biojava/nbio/genome/homology/BlastHomologyHits.java index 0d40fe835c..9fb2ebce48 100644 --- a/biojava-genome/src/main/java/org/biojava/nbio/genome/homology/BlastHomologyHits.java +++ b/biojava-genome/src/main/java/org/biojava/nbio/genome/homology/BlastHomologyHits.java @@ -28,7 +28,7 @@ /** * - * @author Scooter Willis + * @author Scooter Willis */ public class BlastHomologyHits { diff --git a/biojava-genome/src/main/java/org/biojava/nbio/genome/homology/GFF3FromUniprotBlastHits.java b/biojava-genome/src/main/java/org/biojava/nbio/genome/homology/GFF3FromUniprotBlastHits.java index bc6893d19d..67e22bd992 100644 --- a/biojava-genome/src/main/java/org/biojava/nbio/genome/homology/GFF3FromUniprotBlastHits.java +++ b/biojava-genome/src/main/java/org/biojava/nbio/genome/homology/GFF3FromUniprotBlastHits.java @@ -46,7 +46,7 @@ /** * - * @author Scooter Willis + * @author Scooter Willis * @author Mark Chapman */ public class GFF3FromUniprotBlastHits { diff --git a/biojava-genome/src/main/java/org/biojava/nbio/genome/parsers/geneid/GeneIDXMLReader.java b/biojava-genome/src/main/java/org/biojava/nbio/genome/parsers/geneid/GeneIDXMLReader.java index b68074e080..dc6a97e702 100644 --- a/biojava-genome/src/main/java/org/biojava/nbio/genome/parsers/geneid/GeneIDXMLReader.java +++ b/biojava-genome/src/main/java/org/biojava/nbio/genome/parsers/geneid/GeneIDXMLReader.java @@ -37,7 +37,7 @@ /** * - * @author Scooter Willis + * @author Scooter Willis */ public class GeneIDXMLReader { diff --git a/biojava-genome/src/main/java/org/biojava/nbio/genome/parsers/gff/FeatureHelper.java b/biojava-genome/src/main/java/org/biojava/nbio/genome/parsers/gff/FeatureHelper.java index bcdc0bc32b..f18c14a098 100644 --- a/biojava-genome/src/main/java/org/biojava/nbio/genome/parsers/gff/FeatureHelper.java +++ b/biojava-genome/src/main/java/org/biojava/nbio/genome/parsers/gff/FeatureHelper.java @@ -25,7 +25,7 @@ /** * - * @author Scooter Willis + * @author Scooter Willis */ public class FeatureHelper { diff --git a/biojava-genome/src/main/java/org/biojava/nbio/genome/parsers/gff/GCStats.java b/biojava-genome/src/main/java/org/biojava/nbio/genome/parsers/gff/GCStats.java index 2974a13c9c..8ee0881551 100644 --- a/biojava-genome/src/main/java/org/biojava/nbio/genome/parsers/gff/GCStats.java +++ b/biojava-genome/src/main/java/org/biojava/nbio/genome/parsers/gff/GCStats.java @@ -26,7 +26,7 @@ /** * - * @author Scooter Willis + * @author Scooter Willis */ public class GCStats { diff --git a/biojava-genome/src/main/java/org/biojava/nbio/genome/parsers/gff/GFF3Writer.java b/biojava-genome/src/main/java/org/biojava/nbio/genome/parsers/gff/GFF3Writer.java index 7432729d97..88af970928 100644 --- a/biojava-genome/src/main/java/org/biojava/nbio/genome/parsers/gff/GFF3Writer.java +++ b/biojava-genome/src/main/java/org/biojava/nbio/genome/parsers/gff/GFF3Writer.java @@ -31,7 +31,7 @@ /** * - * @author Scooter Willis + * @author Scooter Willis */ public class GFF3Writer { diff --git a/biojava-genome/src/main/java/org/biojava/nbio/genome/parsers/gff/Location.java b/biojava-genome/src/main/java/org/biojava/nbio/genome/parsers/gff/Location.java index d0b2fc8f97..a28f1019fb 100644 --- a/biojava-genome/src/main/java/org/biojava/nbio/genome/parsers/gff/Location.java +++ b/biojava-genome/src/main/java/org/biojava/nbio/genome/parsers/gff/Location.java @@ -135,7 +135,7 @@ public static Location fromBio( int start, int end, char strand ) int s= start - 1; int e= end; - if( !( strand == '-' || strand == '+' || strand == '.' )) + if( strand != '-' && strand != '+' && strand != '.' ) { throw new IllegalArgumentException( "Strand must be '+', '-', or '.'" ); } @@ -166,7 +166,7 @@ public static Location fromBioExt( int start, int length, char strand, int total int s= start; int e= s + length; - if( !( strand == '-' || strand == '+' || strand == '.' )) + if( strand != '-' && strand != '+' && strand != '.' ) { throw new IllegalArgumentException( "Strand must be '+', '-', or '.'" ); } @@ -409,9 +409,9 @@ public LocIterator iterator( int windowSize, int increment ) * The part of this location before the specified position. If position is negative, * count backwards from the end. *

    - * For position >= 0, return Location( start, start + position ). + * For position >= 0, return Location( start, start + position ). *
    - * For position < 0, return Location( start, end + position ). + * For position < 0, return Location( start, end + position ). *
    * @return New location from start of this location to directly before position. * @param position Where the prefix ends. @@ -451,9 +451,9 @@ public Location prefix( int position ) * The part of this location after the specified position. If position is negative, count backwards * from the end. *

    - * For position >= 0, return Location( start + position, end ). + * For position >= 0, return Location( start + position, end ). *
    - * For position < 0, return Location( end - position, end ). + * For position < 0, return Location( end - position, end ). *
    * @return New location from position to end of this location. * @param position Where the suffix starts. diff --git a/biojava-genome/src/main/java/org/biojava/nbio/genome/query/BlastXMLQuery.java b/biojava-genome/src/main/java/org/biojava/nbio/genome/query/BlastXMLQuery.java index 06d65933a9..98f36dd22f 100644 --- a/biojava-genome/src/main/java/org/biojava/nbio/genome/query/BlastXMLQuery.java +++ b/biojava-genome/src/main/java/org/biojava/nbio/genome/query/BlastXMLQuery.java @@ -33,7 +33,7 @@ /** * - * @author Scooter Willis + * @author Scooter Willis */ public class BlastXMLQuery { diff --git a/biojava-genome/src/main/java/org/biojava/nbio/genome/query/OutputHitsGFF.java b/biojava-genome/src/main/java/org/biojava/nbio/genome/query/OutputHitsGFF.java index f7ac399455..5ab5e8f13a 100644 --- a/biojava-genome/src/main/java/org/biojava/nbio/genome/query/OutputHitsGFF.java +++ b/biojava-genome/src/main/java/org/biojava/nbio/genome/query/OutputHitsGFF.java @@ -33,7 +33,7 @@ /** * - * @author Scooter Willis + * @author Scooter Willis */ public class OutputHitsGFF { diff --git a/biojava-genome/src/main/java/org/biojava/nbio/genome/util/SplitFasta.java b/biojava-genome/src/main/java/org/biojava/nbio/genome/util/SplitFasta.java index 374dd378a1..a618443d0f 100644 --- a/biojava-genome/src/main/java/org/biojava/nbio/genome/util/SplitFasta.java +++ b/biojava-genome/src/main/java/org/biojava/nbio/genome/util/SplitFasta.java @@ -35,7 +35,7 @@ /** * Utility to write each Fasta entry to a unique file - * @author Scooter Willis + * @author Scooter Willis */ public class SplitFasta { diff --git a/biojava-genome/src/test/java/org/biojava/nbio/genome/GeneFeatureHelperTest.java b/biojava-genome/src/test/java/org/biojava/nbio/genome/GeneFeatureHelperTest.java index e5e1a8379d..3c81c50916 100644 --- a/biojava-genome/src/test/java/org/biojava/nbio/genome/GeneFeatureHelperTest.java +++ b/biojava-genome/src/test/java/org/biojava/nbio/genome/GeneFeatureHelperTest.java @@ -43,7 +43,7 @@ /** * - * @author Scooter Willis + * @author Scooter Willis */ public class GeneFeatureHelperTest { diff --git a/biojava-integrationtest/pom.xml b/biojava-integrationtest/pom.xml index e092568e29..1c21373bd1 100644 --- a/biojava-integrationtest/pom.xml +++ b/biojava-integrationtest/pom.xml @@ -4,7 +4,7 @@ biojava org.biojava - 7.1.2 + 7.2.5-SNAPSHOT biojava-integrationtest jar @@ -40,7 +40,7 @@ org.biojava biojava-structure - 7.1.2 + 7.2.5-SNAPSHOT diff --git a/biojava-integrationtest/src/test/java/org/biojava/nbio/structure/test/scop/ScopDescriptionTest.java b/biojava-integrationtest/src/test/java/org/biojava/nbio/structure/test/scop/ScopDescriptionTest.java index 39f1fdacf2..5976d635c9 100644 --- a/biojava-integrationtest/src/test/java/org/biojava/nbio/structure/test/scop/ScopDescriptionTest.java +++ b/biojava-integrationtest/src/test/java/org/biojava/nbio/structure/test/scop/ScopDescriptionTest.java @@ -30,7 +30,7 @@ /** - * @author Spencer Bliven + * @author Spencer Bliven sbliven@ucsd.edu * */ public class ScopDescriptionTest { diff --git a/biojava-integrationtest/src/test/java/org/biojava/nbio/structure/test/util/StringManipulationTestsHelper.java b/biojava-integrationtest/src/test/java/org/biojava/nbio/structure/test/util/StringManipulationTestsHelper.java index 578816efb9..23664c68a3 100644 --- a/biojava-integrationtest/src/test/java/org/biojava/nbio/structure/test/util/StringManipulationTestsHelper.java +++ b/biojava-integrationtest/src/test/java/org/biojava/nbio/structure/test/util/StringManipulationTestsHelper.java @@ -42,7 +42,7 @@ public static void assertEqualsIgnoreEndline(String expected, String actual) { /** * Asserts that two XML-representing strings are equal, by recursively - * comparing each node's set of properties & children nodes. This method + * comparing each node's set of properties and children nodes. This method * should be used when two XMLs are considered identical when all nodes are * identical regardless to their order * diff --git a/biojava-modfinder/pom.xml b/biojava-modfinder/pom.xml index 6d7de8bde4..e8de9e38d9 100644 --- a/biojava-modfinder/pom.xml +++ b/biojava-modfinder/pom.xml @@ -4,7 +4,7 @@ biojava org.biojava - 7.1.2 + 7.2.5-SNAPSHOT biojava-modfinder biojava-modfinder @@ -31,7 +31,7 @@ org.biojava biojava-structure - 7.1.2 + 7.2.5-SNAPSHOT jar compile diff --git a/biojava-modfinder/src/main/java/org/biojava/nbio/protmod/Component.java b/biojava-modfinder/src/main/java/org/biojava/nbio/protmod/Component.java index 4a35ff5218..08dafb0626 100644 --- a/biojava-modfinder/src/main/java/org/biojava/nbio/protmod/Component.java +++ b/biojava-modfinder/src/main/java/org/biojava/nbio/protmod/Component.java @@ -30,7 +30,7 @@ * contains information about a certain Component. * The Component class uses the extensible enum pattern. * You can't instantiate Component directly, instead - * you have to use one of the {@link register} and {@link of} methods. + * you have to use one of the register and {@link #of} methods. * * @author Jianjiong Gao * @since 3.0 @@ -109,7 +109,7 @@ public boolean isCTerminal() { /** * Get a Component that does not have to occur at terminals. If the * corresponding component has already been registered, return that one. - * @param pdbccIds possible Protein Data Bank ID. + * @param pdbccId possible Protein Data Bank ID. * @return a component. * @throws IllegalArgumentException if pdbccId or type is null, * or the pdbccId has been registered as a different type. diff --git a/biojava-modfinder/src/main/java/org/biojava/nbio/protmod/ModificationLinkage.java b/biojava-modfinder/src/main/java/org/biojava/nbio/protmod/ModificationLinkage.java index 75ddb4c807..8bbccacce3 100644 --- a/biojava-modfinder/src/main/java/org/biojava/nbio/protmod/ModificationLinkage.java +++ b/biojava-modfinder/src/main/java/org/biojava/nbio/protmod/ModificationLinkage.java @@ -54,10 +54,10 @@ public ModificationLinkage( * * @param components {@link Component}s involved in a modification. * @param indexOfComponent1 index of the first component. - * @param labelOfAtomOnComponent1 label of the atom on the first + * @param pdbNameOfAtomsOnComponent1 label of the atom on the first * component. * @param indexOfComponent2 index of the second component. - * @param labelOfAtomOnComponent2 label of the atom on the second + * @param pdbNameOfAtomsOnComponent2 label of the atom on the second * component. */ public ModificationLinkage( @@ -77,10 +77,10 @@ public ModificationLinkage( * * @param components {@link Component}s involved in a modification. * @param indexOfComponent1 index of the first component. - * @param labelOfAtomOnComponent1 label of the atom on the first + * @param pdbNameOfPotentialAtomsOnComponent1 label of the atom on the first * component. * @param indexOfComponent2 index of the second component. - * @param labelOfAtomOnComponent2 label of the atom on the second + * @param pdbNameOfPotentialAtomsOnComponent2 label of the atom on the second * component. */ public ModificationLinkage( diff --git a/biojava-modfinder/src/main/java/org/biojava/nbio/protmod/ProteinModificationRegistry.java b/biojava-modfinder/src/main/java/org/biojava/nbio/protmod/ProteinModificationRegistry.java index 043aa3d779..383560ab01 100644 --- a/biojava-modfinder/src/main/java/org/biojava/nbio/protmod/ProteinModificationRegistry.java +++ b/biojava-modfinder/src/main/java/org/biojava/nbio/protmod/ProteinModificationRegistry.java @@ -206,7 +206,7 @@ public static void register(final ProteinModification modification) { /** * Remove a modification from registry. - * @param mod + * @param modification */ public static void unregister(ProteinModification modification) { if (modification==null) throw new IllegalArgumentException("modification == null!"); diff --git a/biojava-modfinder/src/main/java/org/biojava/nbio/protmod/structure/ModifiedCompound.java b/biojava-modfinder/src/main/java/org/biojava/nbio/protmod/structure/ModifiedCompound.java index 164c3d86d9..1a65fcdfbc 100644 --- a/biojava-modfinder/src/main/java/org/biojava/nbio/protmod/structure/ModifiedCompound.java +++ b/biojava-modfinder/src/main/java/org/biojava/nbio/protmod/structure/ModifiedCompound.java @@ -47,7 +47,7 @@ public interface ModifiedCompound { /** * - * @return {@link ProteinModificationBean} occurred on the residue. + * @return {@link ProteinModification} occurred on the residue. */ public ProteinModification getModification(); @@ -73,19 +73,18 @@ public interface ModifiedCompound { /** * * @return a set of atom linkages. - * @see #getLinkedGroupPairs * @see StructureAtomLinkage */ public Set getAtomLinkages(); - /** Set atom linkages + /** + * Set atom linkages * - * @return */ public void setAtomLinkages(Set linkages); /** - * Add a linkage. Add new the involved groups first using {@link addGroup}. + * Add a linkage. Add new the involved groups first using addGroup. * @param linkage an atom linkage. * @return true if this linkage was not already contained. * @see StructureAtomLinkage diff --git a/biojava-modfinder/src/main/java/org/biojava/nbio/protmod/structure/ModifiedCompoundImpl.java b/biojava-modfinder/src/main/java/org/biojava/nbio/protmod/structure/ModifiedCompoundImpl.java index 889d3948b2..435772defd 100644 --- a/biojava-modfinder/src/main/java/org/biojava/nbio/protmod/structure/ModifiedCompoundImpl.java +++ b/biojava-modfinder/src/main/java/org/biojava/nbio/protmod/structure/ModifiedCompoundImpl.java @@ -65,7 +65,6 @@ public ModifiedCompoundImpl(){ * Use this constructor for a modified residue. * @param modification {@link ProteinModification}. * @param modifiedResidue modified group. - * @return a {@link ModifiedCompound}. * @throws IllegalArgumentException if either argument is null. */ public ModifiedCompoundImpl ( diff --git a/biojava-ontology/pom.xml b/biojava-ontology/pom.xml index 421b6ea311..6a3fd5cbc4 100644 --- a/biojava-ontology/pom.xml +++ b/biojava-ontology/pom.xml @@ -4,7 +4,7 @@ org.biojava biojava - 7.1.2 + 7.2.5-SNAPSHOT biojava-ontology diff --git a/biojava-ontology/src/main/java/org/biojava/nbio/ontology/Ontology.java b/biojava-ontology/src/main/java/org/biojava/nbio/ontology/Ontology.java index b921fdd243..5463d3ccee 100644 --- a/biojava-ontology/src/main/java/org/biojava/nbio/ontology/Ontology.java +++ b/biojava-ontology/src/main/java/org/biojava/nbio/ontology/Ontology.java @@ -40,7 +40,6 @@ * @author Matthew Pocock * * @since 1.4 - * @see org.biojavax.ontology.ComparableOntology */ public interface Ontology { @@ -129,7 +128,6 @@ public interface Ontology { * some other constraint of this implementation. * @throws AlreadyExistsException if a term of this name already exists * @return The newly created term. - * @throws ChangeVetoException */ public Term createTerm(String name) @@ -148,7 +146,6 @@ public Term createTerm(String name) * some other constraint of this implementation. * @throws AlreadyExistsException if a term of this name already exists * @return The newly created term. - * @throws ChangeVetoException */ public Term createTerm(String name, String description) @@ -168,7 +165,6 @@ public Term createTerm(String name, String description) * some other constraint of this implementation. * @throws AlreadyExistsException if a term of this name already exists * @return The newly created term. - * @throws ChangeVetoException */ public Term createTerm(String name, String description, Object[] synonyms) @@ -187,7 +183,6 @@ public Term createTerm(String name, String description, Object[] synonyms) * some other constraint of this implementation. * @throws AlreadyExistsException if a term of this name already exists * @return The newly created term. - * @throws ChangeVetoException */ public Variable createVariable(String name, String description) @@ -208,7 +203,6 @@ public Variable createVariable(String name, String description) * @param t the Term to import * @param localName the local name to import it under, optionally null * @return a Term - * @throws ChangeVetoException * @throws IllegalArgumentException */ @@ -228,7 +222,6 @@ public Term importTerm(Term t, String localName) * @return a new Triple over these three terms * @throws AlreadyExistsException if a triple already exists with the same * subject, object and predicate, regardless of the name and description - * @throws ChangeVetoException * @throws NullPointerException if subject, object or predicate are null * @throws IllegalArgumentException if subject, object or predicate are not all * from the same ontology @@ -251,7 +244,6 @@ public Triple createTriple(Term subject, Term object, Term predicate, String nam /** * Remove a term from an ontology, together with all triples which refer to it. * @param t - * @throws ChangeVetoException */ public void deleteTerm(Term t) ; diff --git a/biojava-ontology/src/main/java/org/biojava/nbio/ontology/Term.java b/biojava-ontology/src/main/java/org/biojava/nbio/ontology/Term.java index 209c76414f..df26dcbcba 100644 --- a/biojava-ontology/src/main/java/org/biojava/nbio/ontology/Term.java +++ b/biojava-ontology/src/main/java/org/biojava/nbio/ontology/Term.java @@ -32,7 +32,7 @@ /** - * A term in an ontology. This has an {@link org.biojava.nbio.Annotation Annotation} + * A term in an ontology. This has an {@link Annotation Annotation} * which can be used for storing additional human-displayable information. It * is strongly recommended that the Annotation is not used for any machine-readable * data -- this should be represented by relations in the ontology instead. @@ -51,9 +51,7 @@ * @author Thomas Down * @author Matthew Pocock * @since 1.4 - * @see org.biojavax.ontology.ComparableTerm */ - public interface Term extends Annotatable { /** * ChangeType which indicates that this term's ontology has been @@ -113,7 +111,6 @@ public interface Term extends Annotatable { /** * Simple in-memory implementation of an ontology term. - * @see org.biojavax.ontology.SimpleComparableTerm * This can be used to implement Ontology.createTerm */ diff --git a/biojava-ontology/src/main/java/org/biojava/nbio/ontology/Triple.java b/biojava-ontology/src/main/java/org/biojava/nbio/ontology/Triple.java index a265f2ff56..368bfea36e 100644 --- a/biojava-ontology/src/main/java/org/biojava/nbio/ontology/Triple.java +++ b/biojava-ontology/src/main/java/org/biojava/nbio/ontology/Triple.java @@ -41,7 +41,6 @@ * @author Thomas Down * @author Matthew Pocock * @since 1.4 - * @see org.biojavax.ontology.ComparableTriple */ public interface Triple @@ -79,7 +78,6 @@ public interface Triple * If you do not implement hashcode in this way then you have no guarantee * that your Triple objects will be found in an ontology and that they will * not be duplicated. - *

    */ @Override public int hashCode(); @@ -90,7 +88,7 @@ public interface Triple *

    * Two triples are equivalent if they have the same subject, object and * predicate fields. - *

    +	 * 
    {@code
     	 * if (! (o instanceof Triple)) {
     	 *     return false;
     	 * }
    @@ -98,11 +96,10 @@ public interface Triple
     	 * return to.getSubject() == getSubject() &&
     	 *        to.getObject() == getObject() &&
     	 *        to.getPredicate() == getPredicate();
    -	 * 
    + * }
    * If you do not implement equals in this way then you have no guarantee * that your Triple objects will be found in an ontology and that they will * not be duplicated. - *

    */ @Override public boolean equals(Object obj); @@ -111,9 +108,7 @@ public interface Triple * Basic in-memory implementation of a Triple in an ontology * * This can be used to implement Ontology.createTriple - * @see org.biojavax.ontology.SimpleComparableTriple */ - public static final class Impl implements Triple, java.io.Serializable { diff --git a/biojava-ontology/src/main/java/org/biojava/nbio/ontology/io/TabDelimParser.java b/biojava-ontology/src/main/java/org/biojava/nbio/ontology/io/TabDelimParser.java index 2c0ed0a3ae..77259b0e5b 100644 --- a/biojava-ontology/src/main/java/org/biojava/nbio/ontology/io/TabDelimParser.java +++ b/biojava-ontology/src/main/java/org/biojava/nbio/ontology/io/TabDelimParser.java @@ -54,7 +54,7 @@ * the core ontology. *

    * - *
    + * 
      * ...
      * triple	is-a	any
      * triple	has-a	source
    @@ -62,7 +62,7 @@
      * triple	has-a	predicate
      * (triple,has-a,any)	size	3
      * ...
    - * 
    + *
    * *

    * The first four lines just associate triple with some type with a predicate diff --git a/biojava-ontology/src/main/java/org/biojava/nbio/ontology/io/package-info.java b/biojava-ontology/src/main/java/org/biojava/nbio/ontology/io/package-info.java index b6aed42304..43c5d532bc 100644 --- a/biojava-ontology/src/main/java/org/biojava/nbio/ontology/io/package-info.java +++ b/biojava-ontology/src/main/java/org/biojava/nbio/ontology/io/package-info.java @@ -19,10 +19,8 @@ * */ /** - * *

    * Tools for loading and saving ontologies. *

    - * */ package org.biojava.nbio.ontology.io; \ No newline at end of file diff --git a/biojava-ontology/src/main/java/org/biojava/nbio/ontology/obo/OboFileParser.java b/biojava-ontology/src/main/java/org/biojava/nbio/ontology/obo/OboFileParser.java index 96474a5385..8e8a16d174 100644 --- a/biojava-ontology/src/main/java/org/biojava/nbio/ontology/obo/OboFileParser.java +++ b/biojava-ontology/src/main/java/org/biojava/nbio/ontology/obo/OboFileParser.java @@ -33,12 +33,13 @@ import java.util.*; -/** A class to parse the content of an OBO file. It delegates handling of the +/** + * A class to parse the content of an OBO file. It delegates handling of the * content to the OBOFileEventListener implementation. * * This file contains parts of the OBO-Edit file OBOParseEngine, (particularly the encoding and decoding part) * - * http://geneontology.cvs.sourceforge.net/geneontology/go-dev/java/oboedit/sources/org/geneontology/oboedit/dataadapter/OBOParseEngine.java?revision=1.10&view=markup + * See link * Thanks to the OboEdit developers for giving permission to release this in BioJava. * * diff --git a/biojava-ontology/src/main/java/org/biojava/nbio/ontology/utils/Annotatable.java b/biojava-ontology/src/main/java/org/biojava/nbio/ontology/utils/Annotatable.java index 4018aa0655..c1be7a3c99 100644 --- a/biojava-ontology/src/main/java/org/biojava/nbio/ontology/utils/Annotatable.java +++ b/biojava-ontology/src/main/java/org/biojava/nbio/ontology/utils/Annotatable.java @@ -75,7 +75,6 @@ * @author Matthew Pocock * @author Keith James (docs). * @author Kalle Näslund (docs) - * @see org.biojavax.RichAnnotatable * @since 1.0 */ public interface Annotatable { diff --git a/biojava-ontology/src/main/java/org/biojava/nbio/ontology/utils/Annotation.java b/biojava-ontology/src/main/java/org/biojava/nbio/ontology/utils/Annotation.java index a0cf3ce65a..e0ade9cc6b 100644 --- a/biojava-ontology/src/main/java/org/biojava/nbio/ontology/utils/Annotation.java +++ b/biojava-ontology/src/main/java/org/biojava/nbio/ontology/utils/Annotation.java @@ -53,7 +53,6 @@ * * @author Matthew Pocock * @author Thomas Down - * @see org.biojavax.RichAnnotation * * * @since 1.0 @@ -96,8 +95,6 @@ public interface Annotation { * @param value the new value for this key * @throws IllegalArgumentException if the property key is not * legal - * @throws ChangeVetoException if this annotation object can't be changed, or - * if the change was vetoed. */ void setProperty(Object key, Object value) ; @@ -108,7 +105,6 @@ void setProperty(Object key, Object value) * * @param key the key object * @throws NoSuchElementException if the property doesn't exist - * @throws ChangeVetoException if the change is vetoed * @since 1.3 * */ @@ -147,7 +143,7 @@ public void removeProperty(Object key) * A really useful empty and immutable annotation object. *

    * - * Be careful when stooring Annotation arguments to + * Be careful when storing Annotation arguments to * constructors. It is possible that you have been passed EMPTY_ANNOTATION but * that code later on will access this object believing it to be * mutable. For example, the SeqIO factory code clones some diff --git a/biojava-ontology/src/main/java/org/biojava/nbio/ontology/utils/EmptyAnnotation.java b/biojava-ontology/src/main/java/org/biojava/nbio/ontology/utils/EmptyAnnotation.java index 99a48861ea..985d55e911 100644 --- a/biojava-ontology/src/main/java/org/biojava/nbio/ontology/utils/EmptyAnnotation.java +++ b/biojava-ontology/src/main/java/org/biojava/nbio/ontology/utils/EmptyAnnotation.java @@ -35,7 +35,6 @@ * * @since 1.0 as part of Annotation * @since 1.4 as top-level class - * @see org.biojavax.EmptyRichAnnotation */ class EmptyAnnotation diff --git a/biojava-ontology/src/main/java/package-info.java b/biojava-ontology/src/main/java/package-info.java index 56cc7e5eba..7cafa32539 100644 --- a/biojava-ontology/src/main/java/package-info.java +++ b/biojava-ontology/src/main/java/package-info.java @@ -19,7 +19,6 @@ * */ /** - * *

    * A general-purpose API for ontologies. * These are directed graphs consisting of Term obects. Each @@ -30,5 +29,4 @@ *

    Some interfaces and implementations from this package are extended in * {@link org.biojavax.ontology biojavax} to better facilitate their persistence to * biosql.

    - * */ \ No newline at end of file diff --git a/biojava-protein-comparison-tool/pom.xml b/biojava-protein-comparison-tool/pom.xml index 86693d4fdc..cf8cd570a7 100644 --- a/biojava-protein-comparison-tool/pom.xml +++ b/biojava-protein-comparison-tool/pom.xml @@ -4,7 +4,7 @@ biojava org.biojava - 7.1.2 + 7.2.5-SNAPSHOT biojava-protein-comparison-tool @@ -36,23 +36,23 @@ org.biojava biojava-alignment - 7.1.2 + 7.2.5-SNAPSHOT org.biojava biojava-core - 7.1.2 + 7.2.5-SNAPSHOT org.biojava biojava-structure - 7.1.2 + 7.2.5-SNAPSHOT org.biojava biojava-structure-gui - 7.1.2 + 7.2.5-SNAPSHOT net.sourceforge.jmol diff --git a/biojava-protein-disorder/pom.xml b/biojava-protein-disorder/pom.xml index 1afca9d6a6..7273bbff8f 100644 --- a/biojava-protein-disorder/pom.xml +++ b/biojava-protein-disorder/pom.xml @@ -3,7 +3,7 @@ biojava org.biojava - 7.1.2 + 7.2.5-SNAPSHOT biojava-protein-disorder jar @@ -63,7 +63,7 @@ org.biojava biojava-core - 7.1.2 + 7.2.5-SNAPSHOT diff --git a/biojava-protein-disorder/src/main/java/org/biojava/nbio/ronn/Jronn.java b/biojava-protein-disorder/src/main/java/org/biojava/nbio/ronn/Jronn.java index ccb85292b8..91862f0e36 100644 --- a/biojava-protein-disorder/src/main/java/org/biojava/nbio/ronn/Jronn.java +++ b/biojava-protein-disorder/src/main/java/org/biojava/nbio/ronn/Jronn.java @@ -270,7 +270,6 @@ public static Map getDisorder(List sequenc * @throws FileNotFoundException if the input file cannot be found * @throws IOException of the system cannot access or read from the input file * @see #getDisorder(FastaSequence) - * @see #Jronn.Range */ public static Map getDisorder(String fastaFile) throws IOException { final List sequences = SequenceUtil.readFasta(new FileInputStream(fastaFile)); diff --git a/biojava-structure-gui/pom.xml b/biojava-structure-gui/pom.xml index 0a23831c12..581b8a53cc 100644 --- a/biojava-structure-gui/pom.xml +++ b/biojava-structure-gui/pom.xml @@ -3,7 +3,7 @@ biojava org.biojava - 7.1.2 + 7.2.5-SNAPSHOT 4.0.0 biojava-structure-gui @@ -27,13 +27,13 @@ org.biojava biojava-structure - 7.1.2 + 7.2.5-SNAPSHOT compile org.biojava biojava-core - 7.1.2 + 7.2.5-SNAPSHOT compile diff --git a/biojava-structure-gui/src/main/java/demo/AFPFromFasta.java b/biojava-structure-gui/src/main/java/demo/AFPFromFasta.java index 97f32828be..5d91f22aa8 100644 --- a/biojava-structure-gui/src/main/java/demo/AFPFromFasta.java +++ b/biojava-structure-gui/src/main/java/demo/AFPFromFasta.java @@ -41,10 +41,9 @@ /** * Demo displaying a structural alignment from a FASTA file using {@link FastaAFPChainConverter}. - * - * @author dmyerstu - * @see {@link DemoAlignmentFromFasta} Also demonstrates the display of {@link StructureAlignment StructureAlignments} from FASTA sequences, but does so using the more general + * See {@link DemoAlignmentFromFasta} Also demonstrates the display of {@link StructureAlignment StructureAlignments} from FASTA sequences, but does so using the more general * {@link FastaStructureParser} + * @author dmyerstu */ public class AFPFromFasta { diff --git a/biojava-structure-gui/src/main/java/org/biojava/nbio/structure/align/gui/AlignmentCalc.java b/biojava-structure-gui/src/main/java/org/biojava/nbio/structure/align/gui/AlignmentCalc.java index 98ed76f7a4..af2f8f9d91 100644 --- a/biojava-structure-gui/src/main/java/org/biojava/nbio/structure/align/gui/AlignmentCalc.java +++ b/biojava-structure-gui/src/main/java/org/biojava/nbio/structure/align/gui/AlignmentCalc.java @@ -35,13 +35,13 @@ import org.slf4j.LoggerFactory; -/** A class that obtains two structures via DAS and aligns them +/** + * A class that obtains two structures via DAS and aligns them * This is done in a separate thread. * It is possible to register Event listeners to get notification of when the download has finished. * * @author Andreas Prlic * @since 1.7 - * @version %I% %G% */ public class AlignmentCalc implements AlignmentCalculationRunnable { diff --git a/biojava-structure-gui/src/main/java/org/biojava/nbio/structure/align/gui/DotPlotPanel.java b/biojava-structure-gui/src/main/java/org/biojava/nbio/structure/align/gui/DotPlotPanel.java index 0532d91498..b96b10a066 100644 --- a/biojava-structure-gui/src/main/java/org/biojava/nbio/structure/align/gui/DotPlotPanel.java +++ b/biojava-structure-gui/src/main/java/org/biojava/nbio/structure/align/gui/DotPlotPanel.java @@ -56,7 +56,6 @@ public class DotPlotPanel extends ScaleableMatrixPanel { /** * * @param alignment The alignment to plot - * @param background [Optional]A matrix of 'background colors' over which to draw the alignment. * * Originally designed as a matrix of RMSD values between AFPs, so it is colorized * accordingly from red (0) to black (>10). diff --git a/biojava-structure-gui/src/main/java/org/biojava/nbio/structure/align/gui/MemoryMonitor.java b/biojava-structure-gui/src/main/java/org/biojava/nbio/structure/align/gui/MemoryMonitor.java index 91ca7571b4..3c60ab3275 100644 --- a/biojava-structure-gui/src/main/java/org/biojava/nbio/structure/align/gui/MemoryMonitor.java +++ b/biojava-structure-gui/src/main/java/org/biojava/nbio/structure/align/gui/MemoryMonitor.java @@ -51,7 +51,7 @@ /** - * Tracks Memory allocated & used, displayed in graph form. + * Tracks Memory allocated and used, displayed in graph form. */ public class MemoryMonitor extends JPanel { diff --git a/biojava-structure-gui/src/main/java/org/biojava/nbio/structure/align/gui/MenuCreator.java b/biojava-structure-gui/src/main/java/org/biojava/nbio/structure/align/gui/MenuCreator.java index a481d00b91..6a0e3c6e1a 100644 --- a/biojava-structure-gui/src/main/java/org/biojava/nbio/structure/align/gui/MenuCreator.java +++ b/biojava-structure-gui/src/main/java/org/biojava/nbio/structure/align/gui/MenuCreator.java @@ -76,7 +76,7 @@ public class MenuCreator { * Menus included: *
    • File: open, save, export, import, exit. *
    • Align: new pairwise alignment, new multiple alignment. - *
    • View: aligment panel, aligned pairs, text format, + *
    • View: alignment panel, aligned pairs, text format, * FatCat format, distance matrices, dot plot. *
    • Help *
    diff --git a/biojava-structure-gui/src/main/java/org/biojava/nbio/structure/align/gui/MultipleAlignmentJmolDisplay.java b/biojava-structure-gui/src/main/java/org/biojava/nbio/structure/align/gui/MultipleAlignmentJmolDisplay.java index a0b6111a0e..0e7f333e1e 100644 --- a/biojava-structure-gui/src/main/java/org/biojava/nbio/structure/align/gui/MultipleAlignmentJmolDisplay.java +++ b/biojava-structure-gui/src/main/java/org/biojava/nbio/structure/align/gui/MultipleAlignmentJmolDisplay.java @@ -92,6 +92,15 @@ else if (pos < ca.length) { return lst; } + /** + * @deprecated Replace with {@see showMultipleAlignmentPanel} + */ + @Deprecated + public static void showMultipleAligmentPanel(MultipleAlignment multAln, + AbstractAlignmentJmol jmol) throws StructureException { + showMultipleAlignmentPanel(multAln, jmol); + } + /** * Creates a new Frame with the MultipleAlignment Sequence Panel. * The panel can communicate with the Jmol 3D visualization by @@ -102,7 +111,7 @@ else if (pos < ca.length) { * @throws StructureException */ - public static void showMultipleAligmentPanel(MultipleAlignment multAln, + public static void showMultipleAlignmentPanel(MultipleAlignment multAln, AbstractAlignmentJmol jmol) throws StructureException { MultipleAligPanel me = new MultipleAligPanel(multAln, jmol); diff --git a/biojava-structure-gui/src/main/java/org/biojava/nbio/structure/align/gui/MySaveFileListener.java b/biojava-structure-gui/src/main/java/org/biojava/nbio/structure/align/gui/MySaveFileListener.java index f93fba29df..c5c7566eda 100644 --- a/biojava-structure-gui/src/main/java/org/biojava/nbio/structure/align/gui/MySaveFileListener.java +++ b/biojava-structure-gui/src/main/java/org/biojava/nbio/structure/align/gui/MySaveFileListener.java @@ -47,7 +47,7 @@ * and from a Jmol view an XML format is saved. * * @author Aleix Lafita - * @version 2.0 - adapted for MultipleAligments + * @version 2.0 - adapted for MultipleAlignments * */ public class MySaveFileListener implements ActionListener { diff --git a/biojava-structure-gui/src/main/java/org/biojava/nbio/structure/align/gui/SelectPDBPanel.java b/biojava-structure-gui/src/main/java/org/biojava/nbio/structure/align/gui/SelectPDBPanel.java index 240246bb88..41eaf80b1e 100644 --- a/biojava-structure-gui/src/main/java/org/biojava/nbio/structure/align/gui/SelectPDBPanel.java +++ b/biojava-structure-gui/src/main/java/org/biojava/nbio/structure/align/gui/SelectPDBPanel.java @@ -43,7 +43,8 @@ import org.biojava.nbio.structure.gui.util.StructurePairSelector; -/** A Panel that allows user to specify PDB & chain ID, as well as sub-ranges +/** + * A Panel that allows user to specify PDB and chain ID, as well as sub-ranges * * @author Andreas * diff --git a/biojava-structure-gui/src/main/java/org/biojava/nbio/structure/align/gui/aligpanel/MultipleAligPanel.java b/biojava-structure-gui/src/main/java/org/biojava/nbio/structure/align/gui/aligpanel/MultipleAligPanel.java index 483df6f2df..3614907b5b 100644 --- a/biojava-structure-gui/src/main/java/org/biojava/nbio/structure/align/gui/aligpanel/MultipleAligPanel.java +++ b/biojava-structure-gui/src/main/java/org/biojava/nbio/structure/align/gui/aligpanel/MultipleAligPanel.java @@ -154,8 +154,8 @@ public MultipleAligPanel(AFPChain afpChain, Atom[] ca1, Atom[] ca2, /** * Constructor using a MultipleAlignment. * - * @param multAln - * @param colors + * @param msa + * @param jm */ public MultipleAligPanel(MultipleAlignment msa, AbstractAlignmentJmol jm) { this(); diff --git a/biojava-structure-gui/src/main/java/org/biojava/nbio/structure/align/gui/jmol/AbstractAlignmentJmol.java b/biojava-structure-gui/src/main/java/org/biojava/nbio/structure/align/gui/jmol/AbstractAlignmentJmol.java index 4663505797..535ad182fe 100644 --- a/biojava-structure-gui/src/main/java/org/biojava/nbio/structure/align/gui/jmol/AbstractAlignmentJmol.java +++ b/biojava-structure-gui/src/main/java/org/biojava/nbio/structure/align/gui/jmol/AbstractAlignmentJmol.java @@ -196,7 +196,7 @@ public Structure getStructure(){ /** * Set the title of the AlignmentJmol window. - * @param label + * @param title */ public void setTitle(String title){ frame.setTitle(title); diff --git a/biojava-structure-gui/src/main/java/org/biojava/nbio/structure/align/gui/jmol/MultipleAlignmentJmol.java b/biojava-structure-gui/src/main/java/org/biojava/nbio/structure/align/gui/jmol/MultipleAlignmentJmol.java index a9d65c3948..fe1f69346a 100644 --- a/biojava-structure-gui/src/main/java/org/biojava/nbio/structure/align/gui/jmol/MultipleAlignmentJmol.java +++ b/biojava-structure-gui/src/main/java/org/biojava/nbio/structure/align/gui/jmol/MultipleAlignmentJmol.java @@ -385,7 +385,7 @@ public void actionPerformed(ActionEvent ae) { .showAlignmentImage(multAln, result); } else if (cmd.equals(MenuCreator.ALIGNMENT_PANEL)) { - MultipleAlignmentJmolDisplay.showMultipleAligmentPanel(multAln, + MultipleAlignmentJmolDisplay.showMultipleAlignmentPanel(multAln, this); } else if (cmd.equals(MenuCreator.FATCAT_TEXT)) { diff --git a/biojava-structure-gui/src/main/java/org/biojava/nbio/structure/gui/events/package-info.java b/biojava-structure-gui/src/main/java/org/biojava/nbio/structure/gui/events/package-info.java index 138365c88a..001686e4f6 100644 --- a/biojava-structure-gui/src/main/java/org/biojava/nbio/structure/gui/events/package-info.java +++ b/biojava-structure-gui/src/main/java/org/biojava/nbio/structure/gui/events/package-info.java @@ -19,12 +19,10 @@ * */ /** - * *

    * Some event classes for the protein structure GUIs. * Possible start classes are one level higher at * org.biojava.nbio.structure.gui.BiojavaJmol, and org.biojava.nbio.structure.gui.AlignmentGui. *

    - * */ package org.biojava.nbio.structure.gui.events; \ No newline at end of file diff --git a/biojava-structure-gui/src/main/java/org/biojava/nbio/structure/gui/package-info.java b/biojava-structure-gui/src/main/java/org/biojava/nbio/structure/gui/package-info.java index 1a4bc6d6af..ed9ae12804 100644 --- a/biojava-structure-gui/src/main/java/org/biojava/nbio/structure/gui/package-info.java +++ b/biojava-structure-gui/src/main/java/org/biojava/nbio/structure/gui/package-info.java @@ -19,13 +19,11 @@ * */ /** - * *

    * A few convenience classes to view protein structures with Jmol (if it is on the classpath), * to calculate a protein structure alignment and to investigate the internals of the protein structure alignment algorithm. * Possible start classes are BiojavaJmol, AlignmentGui. * Also MVC interface for structure-gui *

    - * */ package org.biojava.nbio.structure.gui; \ No newline at end of file diff --git a/biojava-structure-gui/src/main/java/org/biojava/nbio/structure/gui/util/SequenceScalePanel.java b/biojava-structure-gui/src/main/java/org/biojava/nbio/structure/gui/util/SequenceScalePanel.java index 06542e5271..75da6c8e28 100644 --- a/biojava-structure-gui/src/main/java/org/biojava/nbio/structure/gui/util/SequenceScalePanel.java +++ b/biojava-structure-gui/src/main/java/org/biojava/nbio/structure/gui/util/SequenceScalePanel.java @@ -126,7 +126,7 @@ private void setPrefSize() { public void setAligMap(List apos){ this.apos = apos; - if ( apos.size() == 0) + if (apos.isEmpty()) return; AlignedPosition last = apos.get(apos.size()-1); diff --git a/biojava-structure-gui/src/main/java/org/biojava/nbio/structure/gui/util/color/ContinuousColorMapperTransform.java b/biojava-structure-gui/src/main/java/org/biojava/nbio/structure/gui/util/color/ContinuousColorMapperTransform.java index 5cd010b356..d691a5237d 100644 --- a/biojava-structure-gui/src/main/java/org/biojava/nbio/structure/gui/util/color/ContinuousColorMapperTransform.java +++ b/biojava-structure-gui/src/main/java/org/biojava/nbio/structure/gui/util/color/ContinuousColorMapperTransform.java @@ -60,7 +60,7 @@ public Color getColor(double value) { /** * An arbitrary transform over reals - * @param the input value + * @param value the input value * @return the transformed value */ public abstract double transform(double value); diff --git a/biojava-structure-gui/src/main/java/org/biojava/nbio/structure/gui/util/color/HSVColorSpace.java b/biojava-structure-gui/src/main/java/org/biojava/nbio/structure/gui/util/color/HSVColorSpace.java index 4aafce9f1e..31e3919ae5 100644 --- a/biojava-structure-gui/src/main/java/org/biojava/nbio/structure/gui/util/color/HSVColorSpace.java +++ b/biojava-structure-gui/src/main/java/org/biojava/nbio/structure/gui/util/color/HSVColorSpace.java @@ -79,9 +79,8 @@ public static void main(String[] args) { } + /** - * @param type - * @param numcomponents */ public HSVColorSpace() { super(ColorSpace.TYPE_HSV, 3); diff --git a/biojava-structure-gui/src/main/java/org/biojava/nbio/structure/gui/util/color/LinearColorInterpolator.java b/biojava-structure-gui/src/main/java/org/biojava/nbio/structure/gui/util/color/LinearColorInterpolator.java index 9522ec7a15..2e6d1fc4e4 100644 --- a/biojava-structure-gui/src/main/java/org/biojava/nbio/structure/gui/util/color/LinearColorInterpolator.java +++ b/biojava-structure-gui/src/main/java/org/biojava/nbio/structure/gui/util/color/LinearColorInterpolator.java @@ -142,7 +142,7 @@ public Color interpolate(Color a, Color b, float mixing) { * InterpolationDirections. * * @param colorSpace The color space for interpolation - * @param interpDirection An array of size colorSpace.getNumComponents() + * @param dir An array of size colorSpace.getNumComponents() * giving the interpolation direction for each component. */ public void setColorSpace(ColorSpace colorSpace, InterpolationDirection[] dir) { diff --git a/biojava-structure-gui/src/main/java/org/biojava/nbio/structure/gui/util/package-info.java b/biojava-structure-gui/src/main/java/org/biojava/nbio/structure/gui/util/package-info.java index 2c59281a2c..c820470c62 100644 --- a/biojava-structure-gui/src/main/java/org/biojava/nbio/structure/gui/util/package-info.java +++ b/biojava-structure-gui/src/main/java/org/biojava/nbio/structure/gui/util/package-info.java @@ -19,12 +19,10 @@ * */ /** - * *

    * Some utility classes for the protein structure GUIs. * Possible start classes are one level higher at * org.biojava.nbio.structure.ngui.BiojavaJmol, and org.biojava.nbio.structure.gui.AlignmentGui. *

    - * */ package org.biojava.nbio.structure.gui.util; \ No newline at end of file diff --git a/biojava-structure-gui/src/main/java/org/biojava/nbio/structure/symmetry/gui/SymmetryDisplay.java b/biojava-structure-gui/src/main/java/org/biojava/nbio/structure/symmetry/gui/SymmetryDisplay.java index 52df113942..ea558927a3 100644 --- a/biojava-structure-gui/src/main/java/org/biojava/nbio/structure/symmetry/gui/SymmetryDisplay.java +++ b/biojava-structure-gui/src/main/java/org/biojava/nbio/structure/symmetry/gui/SymmetryDisplay.java @@ -104,7 +104,7 @@ public static MultipleAlignmentJmol displayFull(CeSymmResult symm) * Displays a single structure in a cartoon representation with each * symmetric repeat colored differently. * - * @param msa + * @param symmResult * the symmetry multiple alignment obtained from CeSymm * @throws StructureException */ diff --git a/biojava-structure-gui/src/main/java/org/biojava/nbio/structure/symmetry/jmolScript/JmolSymmetryScriptGenerator.java b/biojava-structure-gui/src/main/java/org/biojava/nbio/structure/symmetry/jmolScript/JmolSymmetryScriptGenerator.java index 8a5764e1bb..507d4c727e 100644 --- a/biojava-structure-gui/src/main/java/org/biojava/nbio/structure/symmetry/jmolScript/JmolSymmetryScriptGenerator.java +++ b/biojava-structure-gui/src/main/java/org/biojava/nbio/structure/symmetry/jmolScript/JmolSymmetryScriptGenerator.java @@ -38,7 +38,7 @@ public abstract class JmolSymmetryScriptGenerator { /** * Returns an instance of a JmolSymmetryScriptGenerator, based on the symmetry of a structure (factory method) * @param axisAligner - * @param rotationGroup + * @param name * @return instance of JmolSymmetryScriptGenerator */ public static JmolSymmetryScriptGenerator getInstance(AxisAligner axisAligner, String name) { diff --git a/biojava-structure-gui/src/main/java/org/biojava/nbio/structure/symmetry/jmolScript/JmolSymmetryScriptGeneratorPointGroup.java b/biojava-structure-gui/src/main/java/org/biojava/nbio/structure/symmetry/jmolScript/JmolSymmetryScriptGeneratorPointGroup.java index 7fd90d2497..d895450dc6 100644 --- a/biojava-structure-gui/src/main/java/org/biojava/nbio/structure/symmetry/jmolScript/JmolSymmetryScriptGeneratorPointGroup.java +++ b/biojava-structure-gui/src/main/java/org/biojava/nbio/structure/symmetry/jmolScript/JmolSymmetryScriptGeneratorPointGroup.java @@ -684,7 +684,8 @@ private String drawSymmetryAxes() { return s.toString(); } - private Vector3d getAligmentVector(Point3d point, Vector3d axis) { + + private Vector3d getAlignmentVector(Point3d point, Vector3d axis) { // for system with a single Cn axis if (rotationGroup.getPointGroup().startsWith("C") || rotationGroup.getPointGroup().startsWith("D")) { // if axis is orthogonal to principal axis, use principal axis as reference axis @@ -760,14 +761,14 @@ private String getSymmetryAxis(int i, int j, String pointGroup, int n, Vector3d if (drawPolygon) { double polygonRadius = getMeanExtension() * 0.06; if (n == 2) { - referenceAxis = getAligmentVector(p1, axis); + referenceAxis = getAlignmentVector(p1, axis); s.append(getC2PolygonJmol(i, p1, referenceAxis, axis, color, polygonRadius, name)); - referenceAxis = getAligmentVector(p2, axis); + referenceAxis = getAlignmentVector(p2, axis); s.append(getC2PolygonJmol(j, p2, referenceAxis, axis, color, polygonRadius, name)); } else if (n > 2) { - referenceAxis = getAligmentVector(p1, axis); + referenceAxis = getAlignmentVector(p1, axis); s.append(getPolygonJmol(i, p1, referenceAxis, axis, n, color, polygonRadius, name)); - referenceAxis = getAligmentVector(p2, axis); + referenceAxis = getAlignmentVector(p2, axis); s.append(getPolygonJmol(j, p2, referenceAxis, axis, n, color, polygonRadius, name)); } } diff --git a/biojava-structure/pom.xml b/biojava-structure/pom.xml index e0baa5bc6b..7fbc64a3c1 100644 --- a/biojava-structure/pom.xml +++ b/biojava-structure/pom.xml @@ -4,7 +4,7 @@ biojava org.biojava - 7.1.2 + 7.2.5-SNAPSHOT biojava-structure biojava-structure @@ -51,13 +51,13 @@ org.biojava biojava-alignment - 7.1.2 + 7.2.5-SNAPSHOT compile org.biojava biojava-core - 7.1.2 + 7.2.5-SNAPSHOT compile diff --git a/biojava-structure/src/main/java/demo/DemoChangeChemCompProvider.java b/biojava-structure/src/main/java/demo/DemoChangeChemCompProvider.java index b198aeb46a..b3c292c92d 100644 --- a/biojava-structure/src/main/java/demo/DemoChangeChemCompProvider.java +++ b/biojava-structure/src/main/java/demo/DemoChangeChemCompProvider.java @@ -34,20 +34,20 @@ /** * This demo shows how to use an alternative ChemCompProvider. The default mechanism in BioJava is to access chemical - * componentsby using the {@link DownloadChemCompProvider}. It fetches and locally caches chemical component - * definitions as they are encountered during file parsing. It can be enabled by using the - * {@link FileParsingParameters#setLoadChemCompInfo(boolean)} method. - * + * components by using the {@link DownloadChemCompProvider}. It fetches and locally caches chemical component + * definitions as they are encountered during file parsing. + *

    * The {@link AllChemCompProvider} downloads and unpacks all chemcomps. It is slower and requires more memory than the * default {@link DownloadChemCompProvider}, but it avoids network access to the FTP site, if a new chemcomp is * detected, that has not been downloaded yet. - * + *

    * Since all chemcomps will be kept in memory, the standard memory that is available to a JVM will not be sufficient * in order to run this demo. Please start with -Xmx200M * * @author Andreas Prlic */ public class DemoChangeChemCompProvider { + public static void main(String[] args){ String pdbId = "1O1G"; boolean loadChemComp = true; diff --git a/biojava-structure/src/main/java/org/biojava/nbio/structure/Atom.java b/biojava-structure/src/main/java/org/biojava/nbio/structure/Atom.java index 2e19acb29a..df38b06205 100644 --- a/biojava-structure/src/main/java/org/biojava/nbio/structure/Atom.java +++ b/biojava-structure/src/main/java/org/biojava/nbio/structure/Atom.java @@ -48,7 +48,7 @@ public interface Atom extends Cloneable, PDBRecord { * @param s a trimmed String specifying the name value * @see #getName */ - public void setName(String s); + void setName(String s); /** * Get atom name, e.g. "CA". @@ -57,42 +57,42 @@ public interface Atom extends Cloneable, PDBRecord { * @return a trimmed String representing the name value * @see #setName */ - public String getName(); + String getName(); /** * Set element of the atom name, e.g. {@link Element#Fe} * @param e an Element enumeration * @see #getElement */ - public void setElement(Element e); + void setElement(Element e); /** * Get element of the atom, e.g. {@link Element#Ca} * @return an Element enumeration * @see #setElement */ - public Element getElement(); + Element getElement(); /** * Set PDB atom number. * @param i an int specifying the PDBserial value * @see #getPDBserial */ - public void setPDBserial(int i) ; + void setPDBserial(int i) ; /** * Get PDB atom number. * @return an int representing the PDBserial value * @see #setPDBserial */ - public int getPDBserial() ; + int getPDBserial() ; /** * Set the coordinates. * @param c an array of doubles specifying the coords value * @see #getCoords */ - public void setCoords(double[] c); + void setCoords(double[] c); /** * Get the coordinates. @@ -100,7 +100,7 @@ public interface Atom extends Cloneable, PDBRecord { * @see #setCoords * @see #getCoordsAsPoint3d() */ - public double[] getCoords() ; + double[] getCoords() ; /** * Get the coordinates. @@ -110,56 +110,56 @@ public interface Atom extends Cloneable, PDBRecord { * @return a reference to the Point3d coordinates * @see #getCoords() */ - public Point3d getCoordsAsPoint3d(); + Point3d getCoordsAsPoint3d(); /** * Set the X coordinate. * @param x a double * @see #getX() */ - public void setX(double x); + void setX(double x); /** * Set the Y coordinate. * @param y a double * @see #getY() */ - public void setY(double y); + void setY(double y); /** * Set the Z coordinate. * @param z a double * @see #getZ() */ - public void setZ(double z); + void setZ(double z); /** * Get coordinate X. * @return a double * @see #setX(double) */ - public double getX() ; + double getX() ; /** * Get coordinate Y. * @return a double * @see #setY(double) */ - public double getY() ; + double getY() ; /** * Get coordinate Z. * @return a double * @see #setZ(double) */ - public double getZ() ; + double getZ() ; /** * Set alternate Location. * @param c a Character object specifying the alt loc value * @see #getAltLoc */ - public void setAltLoc(Character c); + void setAltLoc(Character c); /** * Get alternate Location. @@ -167,41 +167,41 @@ public interface Atom extends Cloneable, PDBRecord { * is represented by ' ' (space character, ascii 32). * @see #setAltLoc */ - public Character getAltLoc(); + Character getAltLoc(); /** * Set occupancy. * @param occupancy a float specifying the occupancy value * @see #getOccupancy */ - public void setOccupancy(float occupancy) ; + void setOccupancy(float occupancy) ; /** * Get occupancy. * @return a float representing the occupancy value * @see #setOccupancy */ - public float getOccupancy(); + float getOccupancy(); /** * Set temp factor . * @param temp a float specifying the temp factor value * @see #getTempFactor */ - public void setTempFactor(float temp) ; + void setTempFactor(float temp) ; /** * Get temp factor. * @return a float representing the temp factor value * @see #setTempFactor */ - public float getTempFactor() ; + float getTempFactor() ; /** * Return an identical copy of this object . * @return an identical copy of this object */ - public Object clone(); + Object clone(); /** * Set the back-reference to its parent Group. @@ -209,7 +209,7 @@ public interface Atom extends Cloneable, PDBRecord { * @see #getGroup() */ - public void setGroup(Group parent); + void setGroup(Group parent); /** * Return the parent Group of the Atom. @@ -217,28 +217,27 @@ public interface Atom extends Cloneable, PDBRecord { * @return Group the parent Group of the Atom, or null * @see #setGroup(Group) */ - public Group getGroup(); + Group getGroup(); /** * Add a bond * @param bond to be added * @see #getBonds() */ - public void addBond(Bond bond); + void addBond(Bond bond); /** * Get all {@link Bond}s this atom is part of. * * @return a list of {@link Bond}s or null if no bonds exist for this Atom */ - public List getBonds(); + List getBonds(); /** * Sets the bonds * @param bonds */ - public void setBonds(List bonds); - + void setBonds(List bonds); /** * Test if another atom has a bond to this atom @@ -246,19 +245,18 @@ public interface Atom extends Cloneable, PDBRecord { * @param other * @return */ - public boolean hasBond(Atom other); + boolean hasBond(Atom other); /** * Get the charge of this atom * * @return a the integer charge. */ - public short getCharge(); + short getCharge(); /** * Set the charge of this atom * - * @return void. */ - public void setCharge(short charge); + void setCharge(short charge); } diff --git a/biojava-structure/src/main/java/org/biojava/nbio/structure/Author.java b/biojava-structure/src/main/java/org/biojava/nbio/structure/Author.java index b0d7253507..bd5a01b885 100644 --- a/biojava-structure/src/main/java/org/biojava/nbio/structure/Author.java +++ b/biojava-structure/src/main/java/org/biojava/nbio/structure/Author.java @@ -62,7 +62,7 @@ public boolean equals(Object obj) { if ((this.surname == null) ? (other.surname != null) : !this.surname.equals(other.surname)) { return false; } - return !((this.initials == null) ? (other.initials != null) : !this.initials.equals(other.initials)); + return (this.initials == null) ? other.initials == null : this.initials.equals(other.initials); } @Override diff --git a/biojava-structure/src/main/java/org/biojava/nbio/structure/BioAssemblyIdentifier.java b/biojava-structure/src/main/java/org/biojava/nbio/structure/BioAssemblyIdentifier.java index 194368d763..eef6de2457 100644 --- a/biojava-structure/src/main/java/org/biojava/nbio/structure/BioAssemblyIdentifier.java +++ b/biojava-structure/src/main/java/org/biojava/nbio/structure/BioAssemblyIdentifier.java @@ -58,7 +58,7 @@ public BioAssemblyIdentifier(String pdbCode, int biolNr) { } /** - * @param pdbCode + * @param pdbId * @param biolNr */ public BioAssemblyIdentifier(PdbId pdbId, int biolNr) { diff --git a/biojava-structure/src/main/java/org/biojava/nbio/structure/Bond.java b/biojava-structure/src/main/java/org/biojava/nbio/structure/Bond.java index 7af10c23e0..ae4c97f74e 100644 --- a/biojava-structure/src/main/java/org/biojava/nbio/structure/Bond.java +++ b/biojava-structure/src/main/java/org/biojava/nbio/structure/Bond.java @@ -26,7 +26,7 @@ * A simple bond -- it stores information about two atoms as well as information * about its bond order. * - * @author Jules Jacobsen + * @author Jules Jacobsen jacobsen@ebi.ac.uk * @author Ulysse Carion */ public interface Bond extends Serializable { @@ -39,7 +39,7 @@ public interface Bond extends Serializable { * @see #getAtomB() * @return one of the two atoms in this bond */ - public Atom getAtomA(); + Atom getAtomA(); /** * Gets atom 'B' of this bond. There is no meaning to which atom is 'A' and @@ -49,7 +49,7 @@ public interface Bond extends Serializable { * @see #getAtomA() * @return one of the two atoms in this bond */ - public Atom getAtomB(); + Atom getAtomB(); /** * A utility method to get the other atom in a bond, given one of its atoms. @@ -66,7 +66,7 @@ public interface Bond extends Serializable { * if the passed atom is not in this bond * @return the atom in this bond that was not passed as an argument */ - public Atom getOther(Atom exclude); + Atom getOther(Atom exclude); /** * Gets the bond order of this bond. A return value of '1' corresponds to a @@ -74,7 +74,7 @@ public interface Bond extends Serializable { * * @return this bond's bond order */ - public int getBondOrder(); + int getBondOrder(); /** * Gets the distance between the two atoms of this bond. @@ -85,5 +85,5 @@ public interface Bond extends Serializable { * * @return the distance between the two atoms of this bond. */ - public double getLength(); + double getLength(); } diff --git a/biojava-structure/src/main/java/org/biojava/nbio/structure/BondImpl.java b/biojava-structure/src/main/java/org/biojava/nbio/structure/BondImpl.java index 3c5fd7af68..4deac44faa 100644 --- a/biojava-structure/src/main/java/org/biojava/nbio/structure/BondImpl.java +++ b/biojava-structure/src/main/java/org/biojava/nbio/structure/BondImpl.java @@ -27,7 +27,7 @@ * A simple bond -- it stores information about two atoms as well as information * about its bond order. * - * @author Jules Jacobsen + * @author Jules Jacobsen jacobsen@ebi.ac.uk * @author Ulysse Carion */ public class BondImpl implements Bond { @@ -44,7 +44,7 @@ public class BondImpl implements Bond { * Note that by forming a bond between atoms 'A' and 'B' with this * constructor, atoms 'A' and 'B' will be updated to have this bond in their * list of bonds. If you do not want this automatic updating, instead use - * {@link #Bond(Atom, Atom, int, boolean)} with the + * {@link #BondImpl(Atom, Atom, int, boolean)} with the * addSelfToAtoms flag set to false. * * @param atomA one of the atoms in this bond @@ -83,7 +83,7 @@ public BondImpl(Atom atomA, Atom atomB, int bondOrder, boolean addSelfToAtoms) { * include this bond. *

    * If you created your Bond with the constructor - * {@link #Bond(Atom, Atom, int)}, this method has already been called for + * {@link #BondImpl(Atom, Atom, int)}, this method has already been called for * you and should not be called again. */ // TODO first check if those bonds haven't been made already diff --git a/biojava-structure/src/main/java/org/biojava/nbio/structure/BondType.java b/biojava-structure/src/main/java/org/biojava/nbio/structure/BondType.java index 9b3f752092..5a8569f396 100644 --- a/biojava-structure/src/main/java/org/biojava/nbio/structure/BondType.java +++ b/biojava-structure/src/main/java/org/biojava/nbio/structure/BondType.java @@ -23,7 +23,7 @@ /** * Work in progress - NOT final! - * @author Jules Jacobsen + * @author Jules Jacobsen jacobsen@ebi.ac.uk */ public enum BondType { UNDEFINED, COVALENT, IONIC, HBOND, VANDERWAALS, HYDROPHOBIC, METAL, PLANAR, ATOM_PLANE; diff --git a/biojava-structure/src/main/java/org/biojava/nbio/structure/Calc.java b/biojava-structure/src/main/java/org/biojava/nbio/structure/Calc.java index b6fde44843..8c92f876f0 100644 --- a/biojava-structure/src/main/java/org/biojava/nbio/structure/Calc.java +++ b/biojava-structure/src/main/java/org/biojava/nbio/structure/Calc.java @@ -327,9 +327,9 @@ public static final double getPsi(AminoAcid a, AminoAcid b) } /** - * Test if two amino acids are connected, i.e. if the distance from C to N < + * Test if two amino acids are connected, i.e. if the distance from C to N < * 2.5 Angstrom. - * + *

    * If one of the AminoAcids has an atom missing, returns false. * * @param a diff --git a/biojava-structure/src/main/java/org/biojava/nbio/structure/Chain.java b/biojava-structure/src/main/java/org/biojava/nbio/structure/Chain.java index 6ceba9fd61..0d067373ca 100644 --- a/biojava-structure/src/main/java/org/biojava/nbio/structure/Chain.java +++ b/biojava-structure/src/main/java/org/biojava/nbio/structure/Chain.java @@ -199,7 +199,7 @@ public interface Chain extends Serializable { * @return the length * @see #getAtomGroup(int) * @see #getAtomGroups() - * @see #getSeqResLength()) + * @see #getSeqResLength() */ int getAtomLength(); @@ -346,18 +346,20 @@ public interface Chain extends Serializable { /** * Get the predominant {@link GroupType} for a given Chain, following these - * rules:

  • if the ratio of number of residues of a certain + * rules: + *
      + *
    • if the ratio of number of residues of a certain * {@link GroupType} to total non-water residues is above the threshold * {@value org.biojava.nbio.structure.StructureTools#RATIO_RESIDUES_TO_TOTAL}, then that {@link GroupType} is * returned
    • if there is no {@link GroupType} that is above the * threshold then the {@link GroupType} with most members is chosen, logging * it
    • + *
    *

    * See also {@link ChemComp#getPolymerType()} and * {@link ChemComp#getResidueType()} which follow the PDB chemical component * dictionary and provide a much more accurate description of groups and * their linking. - *

    * * @return the predominant group type */ diff --git a/biojava-structure/src/main/java/org/biojava/nbio/structure/Element.java b/biojava-structure/src/main/java/org/biojava/nbio/structure/Element.java index 2f534b2828..4e2d3e340a 100644 --- a/biojava-structure/src/main/java/org/biojava/nbio/structure/Element.java +++ b/biojava-structure/src/main/java/org/biojava/nbio/structure/Element.java @@ -424,7 +424,7 @@ public boolean isHeavyAtom() { * @return true if Element is not Hydrogen and not Carbon. */ public boolean isHeteroAtom() { - return !(this == C || this == H); + return this != C && this != H; } /** diff --git a/biojava-structure/src/main/java/org/biojava/nbio/structure/EntityType.java b/biojava-structure/src/main/java/org/biojava/nbio/structure/EntityType.java index de8b5ca4d1..b4978fc582 100644 --- a/biojava-structure/src/main/java/org/biojava/nbio/structure/EntityType.java +++ b/biojava-structure/src/main/java/org/biojava/nbio/structure/EntityType.java @@ -21,8 +21,7 @@ package org.biojava.nbio.structure; /** - * - * The type of entity (polymer, non-polymer, water, macrolide) + * The type of entity (polymer, non-polymer, water, macrolide, branched) * as defined in the mmCIF dictionary: *

    * Entities are of four types: polymer, non-polymer, macrolide and water. @@ -76,10 +75,8 @@ public enum EntityType { /** * @param entType the type of the Entity */ - private EntityType(String entType) { - + EntityType(String entType) { this.setEntityType(entType); - } /** @@ -101,19 +98,15 @@ private void setEntityType(String entityType) { * Returns null if entityType is null or not one of the supported * standard types. * - * @param entityType String value , should be one of "polymer","non-polymer","water","macrolide" - * @return an EntityType object + * @param entityType should be one of "polymer", "non-polymer", "water", "macrolide", "branched" (case insensitive) + * @return an EntityType object or null if the input string doesn't correspond to a known entity */ - public static EntityType entityTypeFromString(String entityType) - { - - if ( entityType == null) + public static EntityType entityTypeFromString(String entityType) { + if (entityType == null) return null; - for(EntityType et : EntityType.values()) - { - if(entityType.equals(et.entityType)) - { + for(EntityType et : EntityType.values()) { + if (entityType.equalsIgnoreCase(et.entityType)) { return et; } } diff --git a/biojava-structure/src/main/java/org/biojava/nbio/structure/Group.java b/biojava-structure/src/main/java/org/biojava/nbio/structure/Group.java index 8b7b5cb809..1ea0d1633e 100644 --- a/biojava-structure/src/main/java/org/biojava/nbio/structure/Group.java +++ b/biojava-structure/src/main/java/org/biojava/nbio/structure/Group.java @@ -346,7 +346,7 @@ public interface Group extends Serializable { * The main group (this group) will contain the first altloc (be it the default '.' or 'A' or a mix of '.' and 'A'). *

    * This method will return the altloc groups that are not the main group, e.g.: - * + *

      *
    • if '.' (default), 'A' and 'B' altlocs are present in file, the main group will contain * the default '.' and this method will return 2 altloc groups *
    • @@ -354,7 +354,7 @@ public interface Group extends Serializable { *
    • if 'A' and 'B' are present in file without a default '.' group, then the main group will contain the 'A' * location whilst this method will return only 1 altloc group with the 'B' location *
    • - * + *
    *

    * Note that atoms with the default altloc (.) are included in all groups. Atoms with other altlocs (typically A, B, etc) * will be sorted into groups by altloc. diff --git a/biojava-structure/src/main/java/org/biojava/nbio/structure/Structure.java b/biojava-structure/src/main/java/org/biojava/nbio/structure/Structure.java index 5a31f407e2..05bd0ba859 100644 --- a/biojava-structure/src/main/java/org/biojava/nbio/structure/Structure.java +++ b/biojava-structure/src/main/java/org/biojava/nbio/structure/Structure.java @@ -31,9 +31,8 @@ /** - * * Interface for a structure object. Provides access to the data of a PDB file. - * + *

    * A structure object allows to access the PDB header information as well * as to the data from the ATOM records. The header information is * currently available through the following objects: @@ -61,50 +60,33 @@ * *

    * The tutorial for the BioJava structure modules can be found at github. - *

    - * - * *
    - * *

    * Q: How can I get a Structure object from a PDB file? - *

    *

    * A: - *

    *
    - *  {@link Structure} loadStructure(String pathToPDBFile){
    - * 		{@link PDBFileReader} pdbreader = new {@link PDBFileReader}();
    - *
    - * 		{@link Structure} structure = null;
    - * 		try{
    - * 			structure = pdbreader.getStructure(pathToPDBFile);
    - * 			System.out.println(structure);
    - * 		} catch (IOException e) {
    - * 			e.printStackTrace();
    - * 		}
    + *  Structure loadStructure(String pathToPDBFile) {
    + * 		PDBFileReader pdbreader = new PDBFileReader();
    + * 		Structure structure = pdbreader.getStructure(pathToPDBFile);
    + * 		System.out.println(structure);
      * 		return structure;
      * 	}
      *  
    * *
    - * *

    * Q: How can I calculate Phi and Psi angles of AminoAcids? - *

    *

    * A: - *

    - *
    - *  void calcPhiPsi({@link Structure} structure){
    - *
    + * 
    {@code
    + *  void calcPhiPsi(Structure structure) {
      *
      * 		// get the first chain from the structure
    - *
    - * 		{@link Chain} chain  = structure.getChain(0);
    + * 		Chain chain  = structure.getChain(0);
      *
      * 		// A protein chain consists of a number of groups. These can be either
    - * 		// {@link AminoAcid}, {@link HetatomImpl Hetatom} or {@link NucleotideImpl Nucleotide} groups.
    + * 		// AminoAcid, HetatomImpl or NucleotideImpl groups.
      * 		//
      * 		// Note: BioJava provides access to both the ATOM and SEQRES data in a PDB file.
      * 		// since we are interested in doing calculations here, we only request the groups
    @@ -113,58 +95,35 @@
      * 		//  get the Groups of the chain that are AminoAcids.
      * 		List groups = chain.getAtomGroups(GroupType.AMINOACID);
      *
    - * 		{@link AminoAcid} a;
    - * 		{@link AminoAcid} b;
    - * 		{@link AminoAcid} c ;
    - *
    - * 		for ( int i=0; i < groups.size(); i++){
    - *
    + * 		AminoAcid a;
    + * 		AminoAcid b;
    + * 		AminoAcid c;
    + * 		for (int i=0; i < groups.size(); i++) {
      * 			// since we requested only groups of type AMINOACID they will always be amino acids
      * 			// Nucleotide and Hetatom groups will not be present in the groups list.
    - *
    - * 			b = ({@link AminoAcid})groups.get(i);
    - *
    - * 			double phi =360.0;
    - * 			double psi =360.0;
    - *
    - * 			if ( i > 0) {
    - * 				a = ({@link AminoAcid})groups.get(i-1) ;
    - * 				try {
    - *
    - * 					// the Calc class provides utility methods for various calculations on
    - * 					// structures, groups and atoms
    - *
    - * 					phi = {@link Calc}.getPhi(a,b);
    - * 				} catch ({@link StructureException} e){
    - * 					e.printStackTrace();
    - * 					phi = 360.0 ;
    - * 				}
    + * 			b = (AminoAcid)groups.get(i);
    + * 			double phi = 360.0;
    + * 			double psi = 360.0;
    + *
    + * 			if (i > 0) {
    + * 				a = (AminoAcid)groups.get(i-1) ;
    + * 				// the Calc class provides utility methods for various calculations on
    + * 				// structures, groups and atoms
    + * 				phi = Calc.getPhi(a,b);
      * 			}
    - * 			if ( i < groups.size()-1) {
    - * 				c = ({@link AminoAcid})groups.get(i+1) ;
    - * 				try {
    - * 					psi = {@link Calc}.getPsi(b,c);
    - * 				}catch ({@link StructureException} e){
    - * 					e.printStackTrace();
    - * 					psi = 360.0 ;
    - * 				}
    + * 			if (i < groups.size()-1) {
    + * 				c = (AminoAcid)groups.get(i+1) ;
    + * 				psi = Calc.getPsi(b, c);
      * 			}
    - *
      * 			System.out.print(b.getPDBCode() + " " + b.getPDBName() + ":"  );
    - *
      * 			System.out.println(String.format("\tphi: %+7.2f psi: %+7.2f", phi, psi));
    - *
      * 		}
    - * 
    + * } + * }
    *
    - * - * - * - * * * @author Andreas Prlic * @since 1.4 - * @version %I% %G% */ public interface Structure extends Cloneable, Serializable { @@ -219,10 +178,10 @@ public interface Structure extends Cloneable, Serializable { /** * Return number of chains of model. * - * @param modelnr an int specifying the number of the Model that should be used + * @param modelIdx an int specifying the index of the Model that should be used * @return an int representing the number of Chains in this Model */ - int size(int modelnr); + int size(int modelIdx); /** * Return the number of models . @@ -273,10 +232,10 @@ public interface Structure extends Cloneable, Serializable { * Retrieve all Chains belonging to a model . * @see #getChains(int modelnr) * - * @param modelnr an int + * @param modelIdx the model index * @return a List object containing the Chains of Model nr. modelnr */ - List getModel(int modelnr); + List getModel(int modelIdx); /** * Retrieve all chains for the first model. @@ -302,17 +261,17 @@ public interface Structure extends Cloneable, Serializable { * Retrieve all chains of a model. * @see #getModel * - * @param modelnr an int + * @param modelIdx the model index * @return a List object containing the Chains of Model nr. modelnr */ - List getChains(int modelnr); + List getChains(int modelIdx); /** * Set the chains for a model * @param chains the chains for a model - * @param modelnr the number of the model + * @param modelIdx the model index */ - void setChains( int modelnr, List chains); + void setChains(int modelIdx, List chains); /** * Return all polymeric chains for the first model @@ -356,7 +315,7 @@ public interface Structure extends Cloneable, Serializable { /** * Return all water chains for the given model index - * @param modelIdx + * @param modelIdx the model index * @return * @since 5.0 */ @@ -373,9 +332,9 @@ public interface Structure extends Cloneable, Serializable { * Add a new chain to the model specified by the given index * * @param chain a Chain object - * @param modelnr an int specifying to which model the Chain should be added + * @param modelIdx an int specifying to which model the Chain should be added */ - void addChain(Chain chain, int modelnr); + void addChain(Chain chain, int modelIdx); /** * Retrieve a chain by its index within the Structure . @@ -389,10 +348,10 @@ public interface Structure extends Cloneable, Serializable { * Retrieve a chain by its indices within the Structure and model. * * @param chainIndex the index of the desired chain in the structure - * @param modelnr the model the desired chain is in + * @param modelIdx the model index * @return a Chain object */ - Chain getChainByIndex(int modelnr, int chainIndex); + Chain getChainByIndex(int modelIdx, int chainIndex); /** * Check if a chain with the chainId aymId is contained in this structure. @@ -435,11 +394,11 @@ public interface Structure extends Cloneable, Serializable { * considers only model nr X. count starts with 0. * @param authId the chain name of the chain to use * @param pdbResnum the PDB residue number of the requested group - * @param modelnr the number of the model to use + * @param modelIdx the model index * @return Group the requested Group * @throws StructureException */ - Group findGroup(String authId, String pdbResnum, int modelnr) throws StructureException; + Group findGroup(String authId, String pdbResnum, int modelIdx) throws StructureException; /** * Retrieve a Chain (polymeric, non-polymeric or water) based on @@ -782,13 +741,11 @@ public interface Structure extends Cloneable, Serializable { * * @param pdb_id a String specifying the PDBCode * @see #getPDBCode - * @deprecated use {@link #setPDBCode(PdbId)} + * @deprecated use {@link #setPdbId(PdbId)} */ @Deprecated void setPDBCode (String pdb_id); - - /** * Returns the PDB identifier associated with this StructureIdentifier. * @return the {@link PdbId} object @@ -796,7 +753,6 @@ public interface Structure extends Cloneable, Serializable { */ PdbId getPdbId(); - /**Sets the {@link PdbId} identifier associated with this structure. * @param pdbId the {@link PdbId} identifier object to set * @since 6.0.0 diff --git a/biojava-structure/src/main/java/org/biojava/nbio/structure/StructureIO.java b/biojava-structure/src/main/java/org/biojava/nbio/structure/StructureIO.java index 9b96705c91..0b802787dd 100644 --- a/biojava-structure/src/main/java/org/biojava/nbio/structure/StructureIO.java +++ b/biojava-structure/src/main/java/org/biojava/nbio/structure/StructureIO.java @@ -81,7 +81,7 @@ public class StructureIO { *
      *
    • If only a PDB code is provided, the whole structure will be return including ligands, but the first model only (for NMR). *
    • Chain IDs are case sensitive, PDB ids are not. To specify a particular chain write as: 4hhb.A or 4HHB.A
    • - *
    • To specify a SCOP domain write a scopId e.g. d2bq6a1. Some flexibility can be allowed in SCOP domain names, see {@link #setStrictSCOP(boolean)}
    • + *
    • To specify a SCOP domain write a scopId e.g. d2bq6a1
    • *
    • URLs are accepted as well
    • *
    * @@ -116,6 +116,7 @@ public static AtomCache getAtomCache() { * Returns the first biological assembly that is available for the given PDB id. *

    * The output Structure will be different depending on the multiModel parameter: + *

      *
    • * the symmetry-expanded chains are added as new models, one per transformId. All original models but * the first one are discarded. @@ -124,9 +125,10 @@ public static AtomCache getAtomCache() { * as original with symmetry-expanded chains added with renamed chain ids and names (in the form * originalAsymId_transformId and originalAuthId_transformId) *
    • + *
    *

    * For more documentation on quaternary structures see: - * {@link http://pdb101.rcsb.org/learn/guide-to-understanding-pdb-data/biological-assemblies} + * http://pdb101.rcsb.org/learn/guide-to-understanding-pdb-data/biological-assemblies * * * @param pdbId @@ -147,7 +149,7 @@ public static Structure getBiologicalAssembly(String pdbId, boolean multiModel) * using multiModel={@value AtomCache#DEFAULT_BIOASSEMBLY_STYLE} *

    * For more documentation on quaternary structures see: - * {@link http://pdb101.rcsb.org/learn/guide-to-understanding-pdb-data/biological-assemblies} + * http://pdb101.rcsb.org/learn/guide-to-understanding-pdb-data/biological-assemblies * * * @param pdbId @@ -163,6 +165,7 @@ public static Structure getBiologicalAssembly(String pdbId) throws IOException, * Returns the biological assembly for the given PDB id and bioassembly identifier. *

    * The output Structure will be different depending on the multiModel parameter: + *

      *
    • * the symmetry-expanded chains are added as new models, one per transformId. All original models but * the first one are discarded. @@ -171,6 +174,7 @@ public static Structure getBiologicalAssembly(String pdbId) throws IOException, * as original with symmetry-expanded chains added with renamed chain ids and names (in the form * originalAsymId_transformId and originalAuthId_transformId) *
    • + *
    * @param pdbId * @param biolAssemblyNr - the ith biological assembly that is available for a PDB ID (we start counting at 1, 0 represents the asym unit). * @param multiModel if true the output Structure will be a multi-model one with one transformId per model, @@ -202,6 +206,7 @@ public static Structure getBiologicalAssembly(String pdbId, int biolAssemblyNr) * Returns all biological assemblies for the given PDB id. *

    * The output Structure will be different depending on the multiModel parameter: + *

      *
    • * the symmetry-expanded chains are added as new models, one per transformId. All original models but * the first one are discarded. @@ -210,6 +215,7 @@ public static Structure getBiologicalAssembly(String pdbId, int biolAssemblyNr) * as original with symmetry-expanded chains added with renamed chain ids and names (in the form * originalAsymId_transformId and originalAuthId_transformId) *
    • + *
    * If only one biological assembly is required use {@link #getBiologicalAssembly(String)} or {@link #getBiologicalAssembly(String, int)} instead. * @param pdbId * @param multiModel if true the output Structure will be a multi-model one with one transformId per model, diff --git a/biojava-structure/src/main/java/org/biojava/nbio/structure/StructureIdentifier.java b/biojava-structure/src/main/java/org/biojava/nbio/structure/StructureIdentifier.java index cc7d8109b2..ba8de5d870 100644 --- a/biojava-structure/src/main/java/org/biojava/nbio/structure/StructureIdentifier.java +++ b/biojava-structure/src/main/java/org/biojava/nbio/structure/StructureIdentifier.java @@ -33,12 +33,12 @@ * An identifier that uniquely identifies a whole {@link Structure} or * arbitrary substructure. Common examples would be reducing a structure to a * single chain, domain, or residue range. - * + *

    * StructureIdentifiers are represented by unique strings. The getId() and fromId() * methods convert to and from the string representation. - * + *

    * Implementations should provide a constructor which takes a String. A static - * fromId(String) method is also recommended. + * fromId(String) method is also recommended. * * @author dmyersturnbull * @author Spencer Bliven @@ -48,7 +48,7 @@ public interface StructureIdentifier extends Serializable { /** * Get the String form of this identifier. * - * It is recommended that the {@link #toString()} method also return the + * It is recommended that the toString() method also return the * identifier, for consistency during serialization. * @return The String form of this identifier */ @@ -59,11 +59,11 @@ public interface StructureIdentifier extends Serializable { * Loads a structure encompassing the structure identified. * The Structure returned should be suitable for passing as * the input to {@link #reduce(Structure)}. - * + *

    * It is recommended that the most complete structure available be returned * (e.g. the full PDB) to allow processing of unselected portions where * appropriate. - * @param AtomCache A potential sources of structures + * @param cache A potential sources of structures * @return A Structure containing at least the atoms identified by this, * or null if Structures are not applicable. * @throws StructureException For errors loading and parsing the structure @@ -92,7 +92,6 @@ public interface StructureIdentifier extends Serializable { * ID should match that returned by getPdbId(), if applicable. * @return * @throws StructureException - * @see StructureTools#getReducedStructure(Structure, String) */ Structure reduce(Structure input) throws StructureException; diff --git a/biojava-structure/src/main/java/org/biojava/nbio/structure/StructureImpl.java b/biojava-structure/src/main/java/org/biojava/nbio/structure/StructureImpl.java index 4fce5b853e..0a697e2d7b 100644 --- a/biojava-structure/src/main/java/org/biojava/nbio/structure/StructureImpl.java +++ b/biojava-structure/src/main/java/org/biojava/nbio/structure/StructureImpl.java @@ -123,20 +123,15 @@ public Structure clone() { n.setDBRefs(this.getDBRefs()); n.setSites(getSites()); - // go through each chain and clone chain for (int i=0;i cloned_model = new ArrayList<>(); for (int j=0;j models.size()) - throw new StructureException(" no model nr " + modelnr + + if ( modelIdx > models.size()) + throw new StructureException(" no model nr " + modelIdx + " in this structure. (contains "+models.size()+")"); - // first we need to gather all groups with the author id chainName: polymers, non-polymers and waters - Chain polyChain = getPolyChainByPDB(chainName, modelnr); + Chain polyChain = getPolyChainByPDB(chainName, modelIdx); if(polyChain != null) { - List groups = new ArrayList<>(); - - groups.addAll(polyChain.getAtomGroups()); + List groups = new ArrayList<>(polyChain.getAtomGroups()); // there can be more than one non-poly chain for a given author id - for (Chain chain: getNonPolyChainsByPDB(chainName, modelnr)) { + for (Chain chain: getNonPolyChainsByPDB(chainName, modelIdx)) { groups.addAll(chain.getAtomGroups()); } - Chain water = getWaterChainByPDB(chainName, modelnr); + Chain water = getWaterChainByPDB(chainName, modelIdx); if (water!=null) groups.addAll(water.getAtomGroups()); - - // now iterate over all groups // in order to find the amino acid that has this pdbRenum. @@ -254,13 +243,12 @@ public void setStructureIdentifier(StructureIdentifier structureIdentifier) { /** {@inheritDoc} */ @Override public void addChain(Chain chain) { - int modelnr = 0 ; - addChain(chain,modelnr); + addChain(chain, 0); } /** {@inheritDoc} */ @Override - public void addChain(Chain chain, int modelnr) { + public void addChain(Chain chain, int modelIdx) { // if model has not been initialized, init it! chain.setStructure(this); if (models.isEmpty()) { @@ -271,37 +259,25 @@ public void addChain(Chain chain, int modelnr) { models.add(model); } else { - Model model = models.get(modelnr); + Model model = models.get(modelIdx); model.addChain(chain); } - - - } - - /** {@inheritDoc} */ @Override public Chain getChainByIndex(int number) { - - int modelnr = 0 ; - - return getChainByIndex(modelnr,number); + return getChainByIndex(0, number); } /** {@inheritDoc} */ @Override - public Chain getChainByIndex(int modelnr,int number) { - - Model model = models.get(modelnr); - + public Chain getChainByIndex(int modelIdx, int number) { + Model model = models.get(modelIdx); return model.getChains().get(number); } - - /** {@inheritDoc} */ @Override public void addModel(List modelChains){ @@ -313,16 +289,12 @@ public void addModel(List modelChains){ models.add(model); } - /** {@inheritDoc} */ @Override public void setChains(List chains){ - - setModel(0,chains); + setModel(0, chains); } - - /** {@inheritDoc} */ @Override public void setModel(int position, List modelChains){ @@ -333,8 +305,6 @@ public void setModel(int position, List modelChains){ c.setStructure(this); //System.out.println("model size:" + models.size()); - - Model model = new Model(); model.setChains(modelChains); @@ -345,12 +315,9 @@ public void setModel(int position, List modelChains){ } } - /** String representation. - * - */ @Override public String toString(){ - String newline = System.getProperty("line.separator"); + String newline = System.lineSeparator(); StringBuilder str = new StringBuilder(); str.append("structure "); str.append(name); @@ -384,17 +351,13 @@ public String toString(){ List hgr = cha.getAtomGroups(GroupType.HETATM); List ngr = cha.getAtomGroups(GroupType.NUCLEOTIDE); - - - str.append("chain ") .append(j).append(": asymId:") .append(cha.getId()) .append(" authId:") .append(cha.getName()).append(" "); - - if ( cha.getEntityInfo() != null){ + if (cha.getEntityInfo() != null){ EntityInfo comp = cha.getEntityInfo(); String molName = comp.getDescription(); if ( molName != null){ @@ -406,7 +369,6 @@ public String toString(){ .append(")"); } - str.append(newline); str.append(" length SEQRES: ").append(cha.getSeqResLength()); str.append(" length ATOM: ").append(cha.getAtomLength()); @@ -425,32 +387,21 @@ public String toString(){ str.append(mol).append(newline); } - return str.toString() ; } @Override public int size() { - int modelnr = 0 ; - if (!models.isEmpty()) { - return models.get(modelnr).getPolyChains().size(); - } - else { + return models.get(0).getPolyChains().size(); + } else { return 0 ; } - } - /** return number of chains of model. - * - */ @Override - public int size(int modelnr) { return models.get(modelnr).size(); } + public int size(int modelIdx) { return models.get(modelIdx).size(); } - // some NMR stuff : - - /** return number of models. */ @Override public int nrModels() { return models.size() ; @@ -520,16 +471,15 @@ public List getChains(int modelIdx){ /** {@inheritDoc} */ @Override public List getChains(){ - if (models.size()==0) { + if (models.isEmpty()) { return new ArrayList<>(0); } return getChains(0); - } @Override public List getPolyChains() { - if (models.size()==0) { + if (models.isEmpty()) { return new ArrayList<>(0); } return getPolyChains(0); @@ -542,7 +492,7 @@ public List getPolyChains(int modelIdx) { @Override public List getNonPolyChains() { - if (models.size()==0) { + if (models.isEmpty()) { return new ArrayList<>(0); } return getNonPolyChains(0); @@ -555,7 +505,7 @@ public List getNonPolyChains(int modelIdx) { @Override public List getWaterChains() { - if (models.size()==0) { + if (models.isEmpty()) { return new ArrayList<>(0); } return getWaterChains(0); @@ -566,55 +516,46 @@ public List getWaterChains(int modelIdx) { return models.get(modelIdx).getWaterChains(); } - - /** {@inheritDoc} */ @Override - public void setChains(int modelnr, List chains){ + public void setChains(int modelIdx, List chains){ for (Chain c: chains){ c.setStructure(this); } - if (models.size()>modelnr) { - models.remove(modelnr); + if (models.size()> modelIdx) { + models.remove(modelIdx); } Model model = new Model(); model.setChains(chains); - models.add(modelnr, model); - + models.add(modelIdx, model); } - /** Retrieve all Chains belonging to a model . - * - * @param modelnr an int - * @return a List object + /** + * {@inheritDoc} */ @Override - public List getModel(int modelnr) { - - return models.get(modelnr).getChains(); + public List getModel(int modelIdx) { + if (models.isEmpty()) return new ArrayList<>(); + return models.get(modelIdx).getChains(); } /** {@inheritDoc} */ @Override - public Chain getChain(String asymId, int modelnr) { - - List chains = getChains(modelnr); + public Chain getChain(String asymId, int modelIdx) { + List chains = getChains(modelIdx); for (Chain c : chains) { if (c.getId().equals(asymId)) { return c; } } return null; - } /** {@inheritDoc} */ @Override public Chain getChain(String asymId) { - return getChain(asymId,0); - } @Override @@ -625,6 +566,8 @@ public Chain getPolyChain(String asymId) { @Override public Chain getPolyChain(String asymId, int modelIdx) { + if (models.isEmpty()) return null; + Model model = models.get(modelIdx); if (model==null) { return null; @@ -637,7 +580,6 @@ public Chain getPolyChain(String asymId, int modelIdx) { return null; } - @Override public Chain getNonPolyChain(String asymId) { return getNonPolyChain(asymId, 0); @@ -655,7 +597,6 @@ public Chain getNonPolyChain(String asymId, int modelIdx) { if (c.getId().equals(asymId)) return c; } - return null; } @@ -693,7 +634,6 @@ public List getNonPolyChainsByPDB(String authId, int modelIdx) { return chains; } - List nonpolyChains = model.getNonPolyChains(); for (Chain c : nonpolyChains){ if (c.getName().equals(authId)) @@ -708,7 +648,6 @@ public Chain getWaterChain(String asymId) { return getWaterChain(asymId, 0); } - @Override public Chain getWaterChain(String asymId, int modelIdx) { Model model = models.get(modelIdx); @@ -729,7 +668,6 @@ public Chain getWaterChainByPDB(String authId) { return getWaterChainByPDB(authId, 0); } - @Override public Chain getWaterChainByPDB(String authId, int modelIdx) { Model model = models.get(modelIdx); @@ -745,8 +683,6 @@ public Chain getWaterChainByPDB(String authId, int modelIdx) { return null; } - - /** {@inheritDoc} */ @Override public String toPDB() { @@ -835,7 +771,6 @@ public EntityInfo getEntityById(int entityId) { return null; } - /** {@inheritDoc} */ @Override public List getDBRefs() { @@ -855,7 +790,6 @@ public void setDBRefs(List dbrefs) { this.dbrefs = dbrefs; } - /** {@inheritDoc} */ @Override public PDBHeader getPDBHeader() { @@ -872,7 +806,6 @@ public void setPDBHeader(PDBHeader pdbHeader){ @Override public List getSSBonds(){ return ssbonds; - } /** {@inheritDoc} */ @@ -882,9 +815,7 @@ public void setSSBonds(List ssbonds){ } /** - * Adds a single disulfide Bond to this structure - * - * @param ssbond the SSBond. + * {@inheritDoc} */ @Override public void addSSBond(Bond ssbond){ @@ -892,10 +823,7 @@ public void addSSBond(Bond ssbond){ } /** - * Return whether or not the entry has an associated journal article - * or publication. The JRNL section is not mandatory and thus may not be - * present. - * @return flag if a JournalArticle could be found. + * R{@inheritDoc} */ @Override public boolean hasJournalArticle() { @@ -903,9 +831,7 @@ public boolean hasJournalArticle() { } /** - * get the associated publication as defined by the JRNL records in a PDB - * file. - * @return a JournalArticle + * {@inheritDoc} */ @Override public JournalArticle getJournalArticle() { @@ -913,9 +839,7 @@ public JournalArticle getJournalArticle() { } /** - * set the associated publication as defined by the JRNL records in a PDB - * file. - * @param journalArticle the article + * {@inheritDoc} */ @Override public void setJournalArticle(JournalArticle journalArticle) { @@ -923,29 +847,21 @@ public void setJournalArticle(JournalArticle journalArticle) { } /** - * @return the sites contained in this structure + * {@inheritDoc} */ - @Override public List getSites() { return sites; } /** - * @param sites the sites to set in the structure + * {@inheritDoc} */ - @Override public void setSites(List sites) { this.sites = sites; } - /** Caution: we should probably remove this to avoid confusion. Currently this is always an empty list! - * - * @return a list of Groups listed in the HET records - this will not - * include any waters. - */ - /** * Sets a flag to indicate if this structure is a biological assembly * @param biologicalAssembly true if biological assembly, otherwise false @@ -1015,7 +931,7 @@ public String getPDBCode () { } /** {@inheritDoc} - * @deprecated use {@link #setPDBCode(PdbId)} + * @deprecated use {@link #setPdbId(PdbId)} * */ @Deprecated @Override @@ -1026,19 +942,17 @@ public void setPDBCode(String pdb_id){ pdbId = new PdbId(pdb_id); } } - - - /** {@inheritDoc} - * @since 6.0.0 - * */ + /** + * {@inheritDoc} + **/ public PdbId getPdbId() { return this.pdbId; } - /** {@inheritDoc} - * @since 6.0.0 - * */ + /** + * {@inheritDoc} + **/ public void setPdbId(PdbId pdbId) { this.pdbId = pdbId; } diff --git a/biojava-structure/src/main/java/org/biojava/nbio/structure/URLIdentifier.java b/biojava-structure/src/main/java/org/biojava/nbio/structure/URLIdentifier.java index 796362809f..3505deaf02 100644 --- a/biojava-structure/src/main/java/org/biojava/nbio/structure/URLIdentifier.java +++ b/biojava-structure/src/main/java/org/biojava/nbio/structure/URLIdentifier.java @@ -42,15 +42,15 @@ /** * Represents a structure loaded from a URL (including a file URL) - * + *

    * A few custom query parameters are supported: * *

      - *
    • format=[pdb|cif] Specify the file format (will otherwise be + *
    • format=[pdb|cif] Specify the file format (will otherwise be * guessed from the extension) - *
    • pdbId=[String] Specify the PDB ID (also guessed from the filename) - *
    • chainID=[String] A single chain from the structure - *
    • residues=[String] Residue ranges, in a form understood by + *
    • pdbId=[String] Specify the PDB ID (also guessed from the filename) + *
    • chainID=[String] A single chain from the structure + *
    • residues=[String] Residue ranges, in a form understood by * {@link SubstructureIdentifier} *
    * @author Spencer Bliven @@ -75,7 +75,7 @@ public class URLIdentifier implements StructureIdentifier { //TODO: should this get renamed to chainname or asymid? public static final String CHAINID_PARAM = "chainid"; /** - * URL parameter specifying residue ranges to include, e.g. residues=A:1-70 + * URL parameter specifying residue ranges to include, e.g. residues=A:1-70 * @see SubstructureIdentifier */ public static final String RESIDUES_PARAM = "residues"; diff --git a/biojava-structure/src/main/java/org/biojava/nbio/structure/align/ClusterAltAligs.java b/biojava-structure/src/main/java/org/biojava/nbio/structure/align/ClusterAltAligs.java index 373bcf1611..0933198d7b 100644 --- a/biojava-structure/src/main/java/org/biojava/nbio/structure/align/ClusterAltAligs.java +++ b/biojava-structure/src/main/java/org/biojava/nbio/structure/align/ClusterAltAligs.java @@ -102,7 +102,7 @@ public static void cluster(AlternativeAlignment[] aligs, int cutoff){ } clusters.add(currentCluster); - if ( remainList.size() == 0) { + if ( remainList.isEmpty()) { break; } } diff --git a/biojava-structure/src/main/java/org/biojava/nbio/structure/align/ce/CECalculator.java b/biojava-structure/src/main/java/org/biojava/nbio/structure/align/ce/CECalculator.java index 6c045ba48e..83f16b7982 100644 --- a/biojava-structure/src/main/java/org/biojava/nbio/structure/align/ce/CECalculator.java +++ b/biojava-structure/src/main/java/org/biojava/nbio/structure/align/ce/CECalculator.java @@ -1450,7 +1450,7 @@ private int optimizeSuperposition(AFPChain afpChain, int nse1, int nse2, int str //afpChain.setTotalRmsdOpt(rmsd); //System.out.println("rmsd: " + rmsd); - if(!(nAtom= strLen * 0.95 && !isRmsdLenAssigned) { rmsdLen=rmsd; isRmsdLenAssigned=true; } diff --git a/biojava-structure/src/main/java/org/biojava/nbio/structure/align/ce/CeCPMain.java b/biojava-structure/src/main/java/org/biojava/nbio/structure/align/ce/CeCPMain.java index 881fc224b4..e40bdce47c 100644 --- a/biojava-structure/src/main/java/org/biojava/nbio/structure/align/ce/CeCPMain.java +++ b/biojava-structure/src/main/java/org/biojava/nbio/structure/align/ce/CeCPMain.java @@ -61,7 +61,7 @@ public class CeCPMain extends CeMain { /** * version history: * 1.5 - Added more parameters to the command line, including -maxOptRMSD - * 1.4 - Added DuplicationHint parameter & default to duplicating the shorter chain + * 1.4 - Added DuplicationHint parameter and default to duplicating the shorter chain * 1.3 - Short CPs are now discarded * 1.2 - now supports check AlignmentTools.isSequentialAlignment. XML protocol * 1.1 - skipped, (trying to avoid confusion with jfatcat in all vs. all comparisons) diff --git a/biojava-structure/src/main/java/org/biojava/nbio/structure/align/ce/CeCalculatorEnhanced.java b/biojava-structure/src/main/java/org/biojava/nbio/structure/align/ce/CeCalculatorEnhanced.java index 4f57161268..cab98b0113 100644 --- a/biojava-structure/src/main/java/org/biojava/nbio/structure/align/ce/CeCalculatorEnhanced.java +++ b/biojava-structure/src/main/java/org/biojava/nbio/structure/align/ce/CeCalculatorEnhanced.java @@ -1455,7 +1455,7 @@ private int optimizeSuperposition(AFPChain afpChain, int nse1, int nse2, int str //afpChain.setTotalRmsdOpt(rmsd); //System.out.println("rmsd: " + rmsd); - if(!(nAtom= strLen * 0.95 && !isRmsdLenAssigned) { rmsdLen=rmsd; isRmsdLenAssigned=true; } diff --git a/biojava-structure/src/main/java/org/biojava/nbio/structure/align/ce/CeMain.java b/biojava-structure/src/main/java/org/biojava/nbio/structure/align/ce/CeMain.java index 70f4acb64f..e35e88fce8 100644 --- a/biojava-structure/src/main/java/org/biojava/nbio/structure/align/ce/CeMain.java +++ b/biojava-structure/src/main/java/org/biojava/nbio/structure/align/ce/CeMain.java @@ -39,7 +39,7 @@ * The original CE paper is available from here: http://peds.oxfordjournals.org/cgi/content/short/11/9/739 * * For a demo of how to use this algorithm, visit the BioJava web site: - * CE usage example. + * CE usage example. * * The BioJava CE version is based on CE version 2.3 (2003 or 2004). * diff --git a/biojava-structure/src/main/java/org/biojava/nbio/structure/align/ce/CeParameters.java b/biojava-structure/src/main/java/org/biojava/nbio/structure/align/ce/CeParameters.java index 106aa08090..b2e7177244 100644 --- a/biojava-structure/src/main/java/org/biojava/nbio/structure/align/ce/CeParameters.java +++ b/biojava-structure/src/main/java/org/biojava/nbio/structure/align/ce/CeParameters.java @@ -342,7 +342,8 @@ public void setDistanceIncrement(Double distanceIncrement) - /** Get the Original RMSD threshold from which the alignment optimization is started + /** + * Get the Original RMSD threshold from which the alignment optimization is started * * @return oRMSDThreshold */ @@ -353,7 +354,8 @@ public Double getORmsdThr() - /** Set the Original RMSD threshold from which the alignment optimization is started + /** + * Set the Original RMSD threshold from which the alignment optimization is started * * @param oRmsdThr the threshold */ @@ -363,16 +365,17 @@ public void setORmsdThr(Double oRmsdThr) } - /** Get the maximum nr of times the (slow) optimiziation of alignment should iterate. Default: unlimited + /** + * Get the maximum nr of times the (slow) optimiziation of alignment should iterate. Default: unlimited * - * @param maxNrIterationsForOptimization */ public int getMaxNrIterationsForOptimization() { return maxNrIterationsForOptimization; } - /** Set the maximum nr of times the (slow) optimiziation of alignment should iterate. Default: unlimited + /** + * Set the maximum nr of times the (slow) optimiziation of alignment should iterate. Default: unlimited * * @param maxNrIterationsForOptimization */ @@ -381,7 +384,8 @@ public void setMaxNrIterationsForOptimization(int maxNrIterationsForOptimization } - /** Should sequence conservation be considered as part of the alignment? If yes, this weight factor allows to determine how much. + /** + * Should sequence conservation be considered as part of the alignment? If yes, this weight factor allows to determine how much. * By default this is set to 0, meaning no contribution of the sequence alignment score. * * @return seqWeight the weight factor (default 0) @@ -392,7 +396,8 @@ public double getSeqWeight() { } - /** Should sequence conservation be considered as part of the alignment? If yes, this weight factor allows to determine how much. + /** + * Should sequence conservation be considered as part of the alignment? If yes, this weight factor allows to determine how much. * By default this is set to 0, meaning no contribution of the sequence alignment score. * * @param seqWeight the weight factor (default 0) diff --git a/biojava-structure/src/main/java/org/biojava/nbio/structure/align/ce/OptimalCECPMain.java b/biojava-structure/src/main/java/org/biojava/nbio/structure/align/ce/OptimalCECPMain.java index 7fa9c4cf28..0f3e4d1283 100644 --- a/biojava-structure/src/main/java/org/biojava/nbio/structure/align/ce/OptimalCECPMain.java +++ b/biojava-structure/src/main/java/org/biojava/nbio/structure/align/ce/OptimalCECPMain.java @@ -300,7 +300,7 @@ private static Matrix permuteMatrix(Matrix mat, int cpRows, int cpCols) { /** * Modifies the {@link AFPChain#setOptAln(int[][][]) optAln} of an AFPChain * by permuting the second protein. - * + *

    * Sets residue numbers in the second protein to (i-cp)%len * * @param afpChain @@ -425,7 +425,7 @@ private static void assignOptAln(AFPChain afpChain, List>> bl /** * Finds the optimal alignment between two proteins allowing for a circular * permutation (CP). - * + *

    * The precise algorithm is controlled by the * {@link OptimalCECPParameters parameters}. If the parameter * {@link OptimalCECPParameters#isTryAllCPs() tryAllCPs} is true, all possible @@ -456,10 +456,9 @@ public AFPChain align(Atom[] ca1, Atom[] ca2, Object param) /** * Finds the optimal alignment between two proteins allowing for a circular * permutation (CP). - * + *

    * This algorithm performs a CE alignment for each possible CP site. This is - * quite slow. Use {@link #alignHeuristic(Atom[], Atom[], Object)} for a - * faster algorithm. + * quite slow. * * @param ca1 CA atoms of the first protein * @param ca2 CA atoms of the second protein diff --git a/biojava-structure/src/main/java/org/biojava/nbio/structure/align/fatcat/calc/AFPChainer.java b/biojava-structure/src/main/java/org/biojava/nbio/structure/align/fatcat/calc/AFPChainer.java index 1d1628b51e..1e9e1cf7d7 100644 --- a/biojava-structure/src/main/java/org/biojava/nbio/structure/align/fatcat/calc/AFPChainer.java +++ b/biojava-structure/src/main/java/org/biojava/nbio/structure/align/fatcat/calc/AFPChainer.java @@ -39,17 +39,17 @@ import javax.vecmath.Matrix4d; -/** a class to chain AFPs to an alignment +/** + * A class to chain AFPs to an alignment * * @author Andreas Prlic - * */ public class AFPChainer { public static final boolean debug = FatCatAligner.debug; // private static final boolean showAlig = false; - /** + /* // Key function: chain (assembly) the AFPs // a AFP (k) is defined as (i, j, k), with i and j are staring points // AFP extension (eg. AFP(k-1) -> AFP(k) ) requiring diff --git a/biojava-structure/src/main/java/org/biojava/nbio/structure/align/model/AFPChain.java b/biojava-structure/src/main/java/org/biojava/nbio/structure/align/model/AFPChain.java index 41cef89031..0c4ee5ec95 100644 --- a/biojava-structure/src/main/java/org/biojava/nbio/structure/align/model/AFPChain.java +++ b/biojava-structure/src/main/java/org/biojava/nbio/structure/align/model/AFPChain.java @@ -973,6 +973,10 @@ public void setOptRmsd(double[] optRmsd) this.optRmsd = optRmsd; } + /** + * The number of aligned residues in the final alignment. + * @return + */ public int getOptLength() { return optLength; @@ -1023,7 +1027,7 @@ public void setAlnseq2(char[] alnseq2) /** * @return The total length of the alignment, including gaps - * @see #getOptLength(), the number of aligned residues in the final alignment. + * @see #getOptLength() */ public int getAlnLength() { @@ -1308,7 +1312,7 @@ public void setSequentialAlignment(boolean sequentialAlignment) { * up to the alignment algorithm. * *

    Note: - * A {@link org.biojava.nbio.structure.gui.JMatrixPanel}, which is used in + * The org.biojava.nbio.structure.gui.JMatrixPanel, used in * the structure-gui package to display distance matrices, will display the * transpose of this matrix. Be sure to take that into account when debugging * visually. diff --git a/biojava-structure/src/main/java/org/biojava/nbio/structure/align/multiple/Block.java b/biojava-structure/src/main/java/org/biojava/nbio/structure/align/multiple/Block.java index 8e79653de6..802d016c68 100644 --- a/biojava-structure/src/main/java/org/biojava/nbio/structure/align/multiple/Block.java +++ b/biojava-structure/src/main/java/org/biojava/nbio/structure/align/multiple/Block.java @@ -72,7 +72,7 @@ public interface Block extends ScoresCache { * alignRes.get(structure).get(residue) = alignRes.get(size).get(length). * * @return List a double List of aligned residues for each structure. - * @see #setAlignRes() + * @see #setAlignRes(List) */ public List> getAlignRes(); @@ -89,7 +89,7 @@ public interface Block extends ScoresCache { * Returns the total number of aligned positions (columns) in the Block. * * @return int number of aligned residues. - * @see #getCoreLength(); + * @see #getCoreLength() * @see #size() */ public int length(); @@ -108,7 +108,6 @@ public interface Block extends ScoresCache { * Block. * * @return int number of aligned residues. - * @see #updateCoreLength() * @see #length() * @see #size() */ @@ -124,8 +123,8 @@ public interface Block extends ScoresCache { /** * Calculates and returns the first position of the specified structure in - * the alignment that is not null. This will return the aligment index, not - * the reisude aligned in that position. + * the alignment that is not null. This will return the alignment index, not + * the residue aligned in that position. * * @param str * structure index @@ -148,8 +147,8 @@ public interface Block extends ScoresCache { /** * Calculates and returns the last position of the specified structure in - * the alignment that is not null. This will return the aligment index, not - * the reisude aligned in that position. + * the alignment that is not null. This will return the alignment index, not + * the residue aligned in that position. * * @param str * structure index diff --git a/biojava-structure/src/main/java/org/biojava/nbio/structure/align/multiple/BlockImpl.java b/biojava-structure/src/main/java/org/biojava/nbio/structure/align/multiple/BlockImpl.java index becc817e85..43da1d7c06 100644 --- a/biojava-structure/src/main/java/org/biojava/nbio/structure/align/multiple/BlockImpl.java +++ b/biojava-structure/src/main/java/org/biojava/nbio/structure/align/multiple/BlockImpl.java @@ -52,7 +52,6 @@ public class BlockImpl extends AbstractScoresCache implements Serializable, * * @param blockSet * the parent BlockSet of the BlockImpl instance. - * @return BlockImpl a BlockImpl instance linked to its parent BlockSet. */ public BlockImpl(BlockSet blockSet) { @@ -69,7 +68,6 @@ public BlockImpl(BlockSet blockSet) { * * @param b * BlockImpl object to be copied. - * @return BlockImpl an identical copy of the input BlockImpl object. */ public BlockImpl(BlockImpl b) { @@ -129,7 +127,7 @@ public void setAlignRes(List> alignRes) { public int length() { if (alignRes == null) return 0; - if (alignRes.size() == 0) + if (alignRes.isEmpty()) return 0; return alignRes.get(0).size(); } diff --git a/biojava-structure/src/main/java/org/biojava/nbio/structure/align/multiple/BlockSet.java b/biojava-structure/src/main/java/org/biojava/nbio/structure/align/multiple/BlockSet.java index 4fdf318c61..ed46d6bbe7 100644 --- a/biojava-structure/src/main/java/org/biojava/nbio/structure/align/multiple/BlockSet.java +++ b/biojava-structure/src/main/java/org/biojava/nbio/structure/align/multiple/BlockSet.java @@ -111,7 +111,7 @@ public interface BlockSet extends ScoresCache { * This may trigger other properties to update which depend on the * superposition. * - * @param matrices + * @param transformations */ public void setTransformations(List transformations); diff --git a/biojava-structure/src/main/java/org/biojava/nbio/structure/align/multiple/BlockSetImpl.java b/biojava-structure/src/main/java/org/biojava/nbio/structure/align/multiple/BlockSetImpl.java index 5282f83b31..344ee3c239 100644 --- a/biojava-structure/src/main/java/org/biojava/nbio/structure/align/multiple/BlockSetImpl.java +++ b/biojava-structure/src/main/java/org/biojava/nbio/structure/align/multiple/BlockSetImpl.java @@ -55,7 +55,6 @@ public class BlockSetImpl extends AbstractScoresCache implements Serializable, * * @param alignment * MultipleAlignment parent of the BlockSet. - * @return BlockSet an instance linked to the parent alignment. */ public BlockSetImpl(MultipleAlignment alignment) { @@ -76,7 +75,6 @@ public BlockSetImpl(MultipleAlignment alignment) { * * @param bs * BlockSet object to be copied. - * @return BlockSet an identical copy of the input object. */ public BlockSetImpl(BlockSetImpl bs) { @@ -181,7 +179,7 @@ public int size() { // Get the size from the variables that can contain the information if (parent != null) return parent.size(); - else if (getBlocks().size() == 0) { + else if (getBlocks().isEmpty()) { throw new IndexOutOfBoundsException( "Empty BlockSet: number of Blocks == 0."); } else @@ -196,7 +194,7 @@ public int getCoreLength() { } protected void updateLength() { - if (getBlocks().size() == 0) { + if (getBlocks().isEmpty()) { throw new IndexOutOfBoundsException( "Empty BlockSet: number of Blocks == 0."); } @@ -209,7 +207,7 @@ protected void updateLength() { } protected void updateCoreLength() { - if (getBlocks().size() == 0) { + if (getBlocks().isEmpty()) { throw new IndexOutOfBoundsException( "Empty BlockSet: number of Blocks == 0."); } diff --git a/biojava-structure/src/main/java/org/biojava/nbio/structure/align/multiple/MultipleAlignmentEnsemble.java b/biojava-structure/src/main/java/org/biojava/nbio/structure/align/multiple/MultipleAlignmentEnsemble.java index d6358a825d..be1c46631c 100644 --- a/biojava-structure/src/main/java/org/biojava/nbio/structure/align/multiple/MultipleAlignmentEnsemble.java +++ b/biojava-structure/src/main/java/org/biojava/nbio/structure/align/multiple/MultipleAlignmentEnsemble.java @@ -147,7 +147,6 @@ public interface MultipleAlignmentEnsemble extends ScoresCache { * structure. * * @return List of Matrix interatomic distance matrices. - * @see #updateDistanceMatrix() */ public List getDistanceMatrix(); @@ -155,7 +154,6 @@ public interface MultipleAlignmentEnsemble extends ScoresCache { * Returns the List of MultipleAlignments in the ensemble. * * @return List of MultipleAlignment in the ensemble. - * @see #setMultipleAlignments() */ public List getMultipleAlignments(); @@ -165,7 +163,6 @@ public interface MultipleAlignmentEnsemble extends ScoresCache { * accessing an index of a List * * @return MultipleAlignment at the index in the ensemble. - * @see #setMultipleAlignments() */ public MultipleAlignment getMultipleAlignment(int index); diff --git a/biojava-structure/src/main/java/org/biojava/nbio/structure/align/multiple/MultipleAlignmentEnsembleImpl.java b/biojava-structure/src/main/java/org/biojava/nbio/structure/align/multiple/MultipleAlignmentEnsembleImpl.java index a6df171705..0f0b442a63 100644 --- a/biojava-structure/src/main/java/org/biojava/nbio/structure/align/multiple/MultipleAlignmentEnsembleImpl.java +++ b/biojava-structure/src/main/java/org/biojava/nbio/structure/align/multiple/MultipleAlignmentEnsembleImpl.java @@ -67,7 +67,6 @@ public class MultipleAlignmentEnsembleImpl extends AbstractScoresCache /** * Default Constructor. Empty ensemble, no structures assigned. * - * @return MultipleAlignmentEnsemble an empty ensemble instance. */ public MultipleAlignmentEnsembleImpl() { @@ -88,7 +87,6 @@ public MultipleAlignmentEnsembleImpl() { * @param structureIdentifiers * List of Structure names, that can be parsed by * {@link AtomCache}. - * @return MultipleAlignmentEnsemble an ensemble with the structures. */ public MultipleAlignmentEnsembleImpl( List structureIdentifiers) { @@ -102,7 +100,6 @@ public MultipleAlignmentEnsembleImpl( * * @param e * MultipleAlignmentEnsemble to copy. - * @return MultipleAlignmentEnsemble identical copy of the input ensemble. */ public MultipleAlignmentEnsembleImpl(MultipleAlignmentEnsembleImpl e) { @@ -153,7 +150,6 @@ public MultipleAlignmentEnsembleImpl(MultipleAlignmentEnsembleImpl e) { * Atoms of the second structure * @param flexible * true if the alignment is flexible (use BlockSets) - * @return MultipleAlignmentEnsemble an ensemble */ public MultipleAlignmentEnsembleImpl(AFPChain afp, Atom[] ca1, Atom[] ca2, boolean flexible) { diff --git a/biojava-structure/src/main/java/org/biojava/nbio/structure/align/multiple/MultipleAlignmentImpl.java b/biojava-structure/src/main/java/org/biojava/nbio/structure/align/multiple/MultipleAlignmentImpl.java index 7f55f1c2f0..06c93a4403 100644 --- a/biojava-structure/src/main/java/org/biojava/nbio/structure/align/multiple/MultipleAlignmentImpl.java +++ b/biojava-structure/src/main/java/org/biojava/nbio/structure/align/multiple/MultipleAlignmentImpl.java @@ -53,7 +53,6 @@ public class MultipleAlignmentImpl extends AbstractScoresCache implements /** * Default Constructor. Empty alignment. No structures assigned. * - * @return MultipleAlignment an empty MultipleAlignment instance. */ public MultipleAlignmentImpl() { this(new MultipleAlignmentEnsembleImpl()); // assign an empty ensemble. @@ -65,7 +64,6 @@ public MultipleAlignmentImpl() { * * @param ensemble * parent MultipleAlignmentEnsemble. - * @return MultipleAlignment an alignment instance part of an ensemble. */ public MultipleAlignmentImpl(MultipleAlignmentEnsemble ensemble) { @@ -87,7 +85,6 @@ public MultipleAlignmentImpl(MultipleAlignmentEnsemble ensemble) { * * @param ma * MultipleAlignmentImpl to copy. - * @return MultipleAlignmentImpl identical copy of the alignment. */ public MultipleAlignmentImpl(MultipleAlignmentImpl ma) { @@ -210,7 +207,7 @@ public int getCoreLength() { * lengths. */ protected void updateLength() { - if (getBlockSets().size() == 0) { + if (getBlockSets().isEmpty()) { throw new IndexOutOfBoundsException( "Empty MultipleAlignment: blockSets size == 0."); } // Otherwise try to calculate it from the BlockSet information @@ -226,7 +223,7 @@ protected void updateLength() { * BlockSet core lengths. */ protected void updateCoreLength() { - if (getBlockSets().size() == 0) { + if (getBlockSets().isEmpty()) { throw new IndexOutOfBoundsException( "Empty MultipleAlignment: blockSets size == 0."); } // Otherwise try to calculate it from the BlockSet information @@ -240,7 +237,6 @@ protected void updateCoreLength() { /** * Updates all cached properties * - * @throws StructureException */ protected void updateCache() { updateCoreLength(); diff --git a/biojava-structure/src/main/java/org/biojava/nbio/structure/align/multiple/mc/MultipleMcMain.java b/biojava-structure/src/main/java/org/biojava/nbio/structure/align/multiple/mc/MultipleMcMain.java index 702ed1d6a5..e68cbe384e 100644 --- a/biojava-structure/src/main/java/org/biojava/nbio/structure/align/multiple/mc/MultipleMcMain.java +++ b/biojava-structure/src/main/java/org/biojava/nbio/structure/align/multiple/mc/MultipleMcMain.java @@ -91,7 +91,7 @@ public class MultipleMcMain implements MultipleStructureAligner { /** * Default constructor. * Default parameters are used. - * @param pairwise the pairwise structure alignment used to generate the + * @param pairwiseAlgo the pairwise structure alignment used to generate the * multiple alignment seed. */ public MultipleMcMain(StructureAlignment pairwiseAlgo){ @@ -177,7 +177,7 @@ private MultipleAlignment generateSeed(List atomArrays) * lowest average RMSD against all others. * The index of this structure is returned. * - * @param alignments List double containing all-to-all pairwise alignments + * @param afpAlignments List double containing all-to-all pairwise alignments * @return int reference index */ private static int chooseReferenceRMSD(List> afpAlignments){ @@ -209,7 +209,7 @@ private static int chooseReferenceRMSD(List> afpAlignments){ * It uses the blocks in AFPChain as {@link Block}s in the * MultipleAlignment, so considers non-topological * alignments, if the alignment is rigid. If the alignment is flexible, - * it considers the blocks as {@link BlockSets}. + * it considers the blocks as {@link BlockSet}s. * * @param afpList the list of pairwise alignments to the reference * @param atomArrays List of Atoms of the structures diff --git a/biojava-structure/src/main/java/org/biojava/nbio/structure/align/multiple/mc/MultipleMcOptimizer.java b/biojava-structure/src/main/java/org/biojava/nbio/structure/align/multiple/mc/MultipleMcOptimizer.java index 83b2247bbe..29c7012801 100644 --- a/biojava-structure/src/main/java/org/biojava/nbio/structure/align/multiple/mc/MultipleMcOptimizer.java +++ b/biojava-structure/src/main/java/org/biojava/nbio/structure/align/multiple/mc/MultipleMcOptimizer.java @@ -108,7 +108,6 @@ public class MultipleMcOptimizer implements Callable { * the parameter beam * @param reference * the index of the most similar structure to all others - * @throws StructureException */ public MultipleMcOptimizer(MultipleAlignment seedAln, MultipleMcParameters params, int reference) { @@ -154,7 +153,7 @@ public MultipleMcOptimizer(MultipleAlignment seedAln, for (Block b : toDelete) { for (BlockSet bs : msa.getBlockSets()) { bs.getBlocks().remove(b); - if (bs.getBlocks().size() == 0) + if (bs.getBlocks().isEmpty()) emptyBs.add(bs); } } @@ -210,7 +209,7 @@ private void initialize() throws StructureException { } } - // Set the superposition and score for the seed aligment + // Set the superposition and score for the seed alignment checkGaps(); msa.clear(); imposer.superimpose(msa); @@ -235,7 +234,7 @@ private void initialize() throws StructureException { *

  • Shrink Block: move a block column to the freePool. *
  • Insert gap: insert a gap in a random position of the alignment. * - *
  • + * */ public MultipleAlignment optimize() throws StructureException { diff --git a/biojava-structure/src/main/java/org/biojava/nbio/structure/align/multiple/util/MultipleAlignmentScorer.java b/biojava-structure/src/main/java/org/biojava/nbio/structure/align/multiple/util/MultipleAlignmentScorer.java index 1a9642e251..b17c5ae8f3 100644 --- a/biojava-structure/src/main/java/org/biojava/nbio/structure/align/multiple/util/MultipleAlignmentScorer.java +++ b/biojava-structure/src/main/java/org/biojava/nbio/structure/align/multiple/util/MultipleAlignmentScorer.java @@ -304,7 +304,7 @@ public static double getAvgTMScore(List transformed, * length. * * @param alignment - * @param reference + * @param ref * Index of the reference structure * @return * @throws StructureException @@ -427,7 +427,7 @@ public static double getMCScore(MultipleAlignment alignment, * Complexity: T(n,l) = O(l*n^2), if n=number of structures and l=alignment * length. * - * @param transformed + * @param trans * List of transformed Atom arrays * @param d0 * parameter for the half-score distance diff --git a/biojava-structure/src/main/java/org/biojava/nbio/structure/align/multiple/util/MultipleAlignmentTools.java b/biojava-structure/src/main/java/org/biojava/nbio/structure/align/multiple/util/MultipleAlignmentTools.java index 836d5c922a..543aaa8405 100644 --- a/biojava-structure/src/main/java/org/biojava/nbio/structure/align/multiple/util/MultipleAlignmentTools.java +++ b/biojava-structure/src/main/java/org/biojava/nbio/structure/align/multiple/util/MultipleAlignmentTools.java @@ -57,6 +57,7 @@ import org.biojava.nbio.structure.align.multiple.BlockSet; import org.biojava.nbio.structure.align.multiple.MultipleAlignment; import org.biojava.nbio.structure.align.util.AlignmentTools; +import org.biojava.nbio.structure.cluster.SubunitCluster; import org.biojava.nbio.structure.jama.Matrix; import org.forester.evoinference.matrix.distance.BasicSymmetricalDistanceMatrix; import org.forester.phylogeny.Phylogeny; @@ -308,7 +309,7 @@ public static List getSequenceAlignment( * Blocks is indicated by a gap in all positions, meaning that there is a * possible discontinuity. * - * @param alignment + * @param msa * input MultipleAlignment * @return String for each row in the alignment, giving the 1-letter code * for each aligned residue. @@ -465,7 +466,7 @@ else if (previousPos[str] + 1 == residue) { * gap in all positions, meaning that there is something unaligned * inbetween. * - * @param alignment + * @param ma * input MultipleAlignment * @return String for each row in the alignment, giving the 1-letter code * for each aligned residue. @@ -478,7 +479,7 @@ public static List getBlockSequenceAlignment(MultipleAlignment ma) { * Returns the Atom of the specified structure that is aligned in the * sequence alignment position specified. * - * @param multAln + * @param msa * the MultipleAlignment object from where the sequence alignment * has been generated * @param mapSeqToStruct @@ -567,7 +568,7 @@ public static int getBlockForSequencePosition(MultipleAlignment multAln, * Complexity: T(n,l) = O(l*n^2), if n=number of structures and l=alignment * length. * - * @param alignment + * @param msa * MultipleAlignment * @return Matrix containing all average residue distances */ @@ -643,7 +644,7 @@ public static Matrix getAverageResidueDistances(List transformed) { *

    * For each structure in the alignment, returns an atom for each * representative atom in the aligned columns, omitting unaligned residues - * (i.e. an array of length alignment.length() ). + * (i.e. an array of length alignment.length() ). *

    * All blocks are concatenated together, so Atoms may not appear in the same * order as in their parent structure. If the alignment blocks contain null @@ -721,7 +722,7 @@ public static List transformAtoms(MultipleAlignment alignment) { /** * Calculate a List of alignment indicies that correspond to the core of a - * Block, which means that all structures have a residue in that positon. + * Block, which means that all structures have a residue in that position. * * @param block * alignment Block @@ -939,7 +940,6 @@ public static Phylogeny getHSDMTree(MultipleAlignment msta) * @param msta * MultipleAlignment of protein structures * @return Phylogeny phylogenetic tree - * @throws CompoundNotFoundException */ public static Phylogeny getStructuralTree(MultipleAlignment msta) { double[][] rmsdMat = MultipleAlignmentTools.getRMSDMatrix(msta) @@ -964,4 +964,46 @@ public static Phylogeny getStructuralTree(MultipleAlignment msta) { return tree; } + /** + * Convert an MSA into a matrix of equivalent residues. + * + * This concatenates all blocks, meaning that the indices might not be + * sequential. + * + * Indices should be consistent with `msa.getAtomArrays()`. + * @param msa Multiple alignment + * @param coreOnly Include only core (ungapped) columns. Otherwise gaps are + * represented with null. + * @return + */ + public static List> getEquivalentResidues(MultipleAlignment msa, boolean coreOnly) { + List> eqr = new ArrayList<>(); + for (int str = 0; str < msa.size(); str++) { + eqr.add(new ArrayList<>()); + } + + for(Block block: msa.getBlocks()) { + List> aln = block.getAlignRes(); + for (int col = 0; col < block.length(); col++) { + // skip non-core columns + if(coreOnly) { + boolean core = true; + for (int str = 0; str < block.size(); str++) { + if (aln.get(str).get(col) == null) { + core = false; + break; + } + } + if(!core) { + continue; + } + } + // add column to eqr + for (int str = 0; str < block.size(); str++) { + eqr.get(str).add(aln.get(str).get(col)); + } + } + } + return eqr; + } } diff --git a/biojava-structure/src/main/java/org/biojava/nbio/structure/align/multiple/util/MultipleAlignmentWriter.java b/biojava-structure/src/main/java/org/biojava/nbio/structure/align/multiple/util/MultipleAlignmentWriter.java index 7db5d2e714..771b8b5f68 100644 --- a/biojava-structure/src/main/java/org/biojava/nbio/structure/align/multiple/util/MultipleAlignmentWriter.java +++ b/biojava-structure/src/main/java/org/biojava/nbio/structure/align/multiple/util/MultipleAlignmentWriter.java @@ -194,7 +194,7 @@ public static String toAlignedResidues(MultipleAlignment multAln) { * Converts the transformation Matrices of the alignment into a String * output. * - * @param afpChain + * @param alignment * @return String transformation Matrices */ public static String toTransformMatrices(MultipleAlignment alignment) { @@ -289,7 +289,7 @@ public static String toXML(MultipleAlignmentEnsemble ensemble) * ATOM 2004 CA ARG 4 32.662 -25.111 7.172 132 ARG * ATOM 2005 CA GLY 5 29.121 -25.194 8.602 133 ARG * - * Column 1 -30: Atom & Residue records of query sequence. + * Column 1 -30: Atom and Residue records of query sequence. * Column 31-54: Coordinates of atoms in query copied from corresponding atoms in template. * Column 55-59: Corresponding residue number in template based on alignment * Column 60-64: Corresponding residue name in template diff --git a/biojava-structure/src/main/java/org/biojava/nbio/structure/align/quaternary/QsAlignResult.java b/biojava-structure/src/main/java/org/biojava/nbio/structure/align/quaternary/QsAlignResult.java index 7ac77a602e..fe1c9c411b 100644 --- a/biojava-structure/src/main/java/org/biojava/nbio/structure/align/quaternary/QsAlignResult.java +++ b/biojava-structure/src/main/java/org/biojava/nbio/structure/align/quaternary/QsAlignResult.java @@ -117,7 +117,7 @@ public void setSubunitMap(Map subunitMap) { "Subunit Map index higher than Subunit List size."); // Update the relation enum - if (subunitMap.size() == 0) { + if (subunitMap.isEmpty()) { relation = QsRelation.DIFFERENT; } else if (subunitMap.keySet().size() == subunits1.size()) { if (subunitMap.values().size() == subunits2.size()) { diff --git a/biojava-structure/src/main/java/org/biojava/nbio/structure/align/util/AFPAlignmentDisplay.java b/biojava-structure/src/main/java/org/biojava/nbio/structure/align/util/AFPAlignmentDisplay.java index 11f36456ab..8d053a2520 100644 --- a/biojava-structure/src/main/java/org/biojava/nbio/structure/align/util/AFPAlignmentDisplay.java +++ b/biojava-structure/src/main/java/org/biojava/nbio/structure/align/util/AFPAlignmentDisplay.java @@ -168,8 +168,9 @@ public static void getAlign(AFPChain afpChain,Atom[] ca1,Atom[] ca2) { *

      *
    • {@link AFPChain#getOptAln()} and lengths *
    - * - *
    Known Bugs
    + *

    + * Known Bugs: + *

    * Expects the alignment to have linear topology. May give odd results * for circular permutations and other complicated topologies. * diff --git a/biojava-structure/src/main/java/org/biojava/nbio/structure/align/util/AlignmentTools.java b/biojava-structure/src/main/java/org/biojava/nbio/structure/align/util/AlignmentTools.java index 82d38d010c..c6791f4ed2 100644 --- a/biojava-structure/src/main/java/org/biojava/nbio/structure/align/util/AlignmentTools.java +++ b/biojava-structure/src/main/java/org/biojava/nbio/structure/align/util/AlignmentTools.java @@ -72,7 +72,7 @@ public class AlignmentTools { * Since algorithms which create non-sequential alignments split the * alignment into multiple blocks, some computational time can be saved * by only checking block boundaries for sequentiality. Setting - * checkWithinBlocks to true makes this function slower, + * checkWithinBlocks to true makes this function slower, * but detects AFPChains with non-sequential blocks. * * Note that this method should give the same results as @@ -209,7 +209,7 @@ public static Map applyAlignment(Map alignmentMap, int k) { * @param * @param alignmentMap The input function, as a map (see {@link AlignmentTools#alignmentAsMap(AFPChain)}) * @param identity An identity-like function providing the isomorphism between - * the codomain of alignmentMap (of type ) and the domain (type ). + * the codomain of alignmentMap (of type T) and the domain (type S). * @param k The number of times to apply the alignment * @return A new alignment. If the input function is not automorphic * (one-to-one), then some inputs may map to null, indicating that the @@ -239,8 +239,6 @@ public static Map applyAlignment(Map alignmentMap, Map ide } } - - Map imageMap = new HashMap<>(alignmentMap.size()); //TODO handle nulls consistently. @@ -282,7 +280,7 @@ public static Map applyAlignment(Map alignmentMap, Map ide */ public static int getSymmetryOrder(Map alignment, final int maxSymmetry, final float minimumMetricChange) { - return getSymmetryOrder(alignment, new IdentityMap(), maxSymmetry, minimumMetricChange); + return getSymmetryOrder(alignment, new IdentityMap<>(), maxSymmetry, minimumMetricChange); } /** * Tries to detect symmetry in an alignment. @@ -303,7 +301,7 @@ public static int getSymmetryOrder(Map alignment, * identity. If n corresponds to the intrinsic order of the alignment, * this will be small. This algorithm tries increasing values of n * and looks for abrupt decreases in the root mean squared offset. - * If none are found at n<=maxSymmetry, the alignment is reported as + * If none are found at n<=maxSymmetry, the alignment is reported as * non-symmetric. * * @param alignment The alignment to test for symmetry @@ -314,7 +312,7 @@ public static int getSymmetryOrder(Map alignment, * the calculation time and can lead to overfitting. * @param minimumMetricChange Percent decrease in root mean squared offsets * in order to declare symmetry. 0.4f seems to work well for CeSymm. - * @return The order of symmetry of alignment, or 1 if no order <= + * @return The order of symmetry of alignment, or 1 if no order <= * maxSymmetry is found. * * @see IdentityMap For a simple identity function @@ -470,9 +468,10 @@ public static Map guessSequentialAlignment( * Retrieves the optimum alignment from an AFPChain and returns it as a * java collection. The result is indexed in the same way as * {@link AFPChain#getOptAln()}, but has the correct size(). - *

    +	 * 
    {@code
     	 * List>> aln = getOptAlnAsList(AFPChain afpChain);
    -	 * aln.get(blockNum).get(structureNum={0,1}).get(pos)
    + * aln.get(blockNum).get(structureNum={0,1}).get(pos) + * }
    * * @param afpChain * @return @@ -503,7 +502,7 @@ public static List>> getOptAlnAsList(AFPChain afpChain) { /** - * A Map can be viewed as a function from K to V. This class represents + * A {@code Map} can be viewed as a function from K to V. This class represents * the identity function. Getting a value results in the value itself. * *

    The class is a bit inconsistent when representing its contents. On @@ -850,7 +849,7 @@ public static AFPChain replaceOptAln(AFPChain afpChain, Atom[] ca1, Atom[] ca2, * @param ca1 * @param ca2 Second set of ca atoms. Will be modified based on the superposition * @throws StructureException - * @see {@link CECalculator#calc_rmsd(Atom[], Atom[], int, boolean)} + * @see CECalculator#calc_rmsd(Atom[], Atom[], int, boolean) * contains much of the same code, but stores results in a CECalculator * instance rather than an AFPChain */ @@ -979,12 +978,13 @@ public static Object resizeArray (Object oldArray, int newSize) { *

    Note that more concise representations may be possible.

    * * Examples: + *
      *
    • 1>2>3>1
    • *
    • 1>2>3>2 4>3
    • - * + *
    * @param alignment The input function, as a map (see {@link AlignmentTools#alignmentAsMap(AFPChain)}) * @param identity An identity-like function providing the isomorphism between - * the codomain of alignment (of type ) and the domain (type ). + * the codomain of alignment (of type T) and the domain (type S). * @return */ public static String toConciseAlignmentString(Map alignment, Map identity) { @@ -1076,9 +1076,9 @@ public static Map fromConciseAlignmentString(String string) { /** * Method that calculates the number of gaps in each subunit block of an optimal AFP alignment. - * - * INPUT: an optimal alignment in the format int[][][]. - * OUTPUT: an int[] array of length containing the gaps in each block as int[block]. + * @param optAln + * an optimal alignment in the format int[][][] + * @return an int[] array of order length containing the gaps in each block as int[block] */ public static int[] calculateBlockGap(int[][][] optAln){ @@ -1197,7 +1197,6 @@ public static void alignmentToSIF(Writer out,AFPChain afpChain, * Does NOT rotate anything. * @param ca * @return a list of Chains that is built up from the Atoms in the ca array - * @throws StructureException */ public static final List getAlignedModel(Atom[] ca){ diff --git a/biojava-structure/src/main/java/org/biojava/nbio/structure/align/util/AtomCache.java b/biojava-structure/src/main/java/org/biojava/nbio/structure/align/util/AtomCache.java index 63fc089a97..71b8a3da22 100644 --- a/biojava-structure/src/main/java/org/biojava/nbio/structure/align/util/AtomCache.java +++ b/biojava-structure/src/main/java/org/biojava/nbio/structure/align/util/AtomCache.java @@ -162,7 +162,6 @@ public AtomCache(UserConfiguration config) { * @return an array of Atoms. * @throws IOException * @throws StructureException - * @see */ public Atom[] getAtoms(String name) throws IOException, StructureException { return getAtoms(new StructureName(name)); @@ -189,7 +188,6 @@ public Atom[] getAtoms(StructureIdentifier name) throws IOException, StructureEx * @return an array of Atoms. * @throws IOException * @throws StructureException - * @see */ public Atom[] getRepresentativeAtoms(String name) throws IOException, StructureException { return getRepresentativeAtoms(new StructureName(name)); @@ -223,14 +221,14 @@ public Atom[] getRepresentativeAtoms(StructureIdentifier name) throws IOExceptio * if false the outputStructure will be as the original with added chains with renamed asymIds (in the form originalAsymId_transformId and originalAuthId_transformId). * @return a structure object * @throws IOException - * @throws StructureException if biassemblyId < 0 or other problems while loading structure + * @throws StructureException if biassemblyId < 0 or other problems while loading structure * @since 3.2 */ public Structure getBiologicalAssembly(String pdbId, int bioAssemblyId, boolean multiModel) throws StructureException, IOException { return getBiologicalAssembly(new PdbId(pdbId), bioAssemblyId, multiModel); } - + /** * Returns the biological assembly for a given PDB ID and bioAssemblyId, by building the * assembly from the biounit annotations found in {@link Structure#getPDBHeader()} @@ -247,7 +245,7 @@ public Structure getBiologicalAssembly(String pdbId, int bioAssemblyId, boolean * if false the outputStructure will be as the original with added chains with renamed asymIds (in the form originalAsymId_transformId and originalAuthId_transformId). * @return a structure object * @throws IOException - * @throws StructureException if biassemblyId < 0 or other problems while loading structure + * @throws StructureException if biassemblyId < 0 or other problems while loading structure * @since 6.0.0 */ public Structure getBiologicalAssembly(PdbId pdbId, int bioAssemblyId, boolean multiModel) @@ -286,7 +284,7 @@ public Structure getBiologicalAssembly(PdbId pdbId, int bioAssemblyId, boolean m asymUnit.getPDBHeader().getBioAssemblies().get(bioAssemblyId).getTransforms(); - if (transformations == null || transformations.size() == 0) { + if (transformations == null || transformations.isEmpty()) { throw new StructureException("Could not load transformations to recreate biological assembly id " + bioAssemblyId + " of " + pdbId); } @@ -305,7 +303,7 @@ public Structure getBiologicalAssembly(PdbId pdbId, int bioAssemblyId, boolean m * the asymmetric unit will be returned, e.g. for NMR structures. * *

    Biological assemblies can also be accessed using - * getStructure("BIO:[pdbId]") + * getStructure("BIO:[pdbId]") * @param pdbId the PDB id * @param multiModel if true the output Structure will be a multi-model one with one transformId per model, * if false the outputStructure will be as the original with added chains with renamed asymIds (in the form originalAsymId_transformId and originalAuthId_transformId). @@ -341,7 +339,7 @@ public Structure getBiologicalAssembly(String pdbId, boolean multiModel) throws asymUnit.getPDBHeader().getBioAssemblies().get(bioAssemblyId).getTransforms(); - if (transformations == null || transformations.size() == 0) { + if (transformations == null || transformations.isEmpty()) { throw new StructureException("Could not load transformations to recreate biological assembly id " + bioAssemblyId + " of " + pdbId); } @@ -387,7 +385,7 @@ public List getBiologicalAssemblies(String pdbId, boolean multiModel) List transformations = asymUnit.getPDBHeader().getBioAssemblies().get(bioAssemblyId).getTransforms(); - if (transformations == null || transformations.size() == 0) { + if (transformations == null || transformations.isEmpty()) { logger.info("Could not load transformations to recreate biological assembly id {} of {}. Assembly " + "id will be missing in biological assemblies.", bioAssemblyId, pdbId); continue; @@ -466,8 +464,7 @@ public String getPath() { *

  • If only a PDB code is provided, the whole structure will be return including ligands, but the first model * only (for NMR). *
  • Chain IDs are case sensitive, PDB ids are not. To specify a particular chain write as: 4hhb.A or 4HHB.A
  • - *
  • To specify a SCOP domain write a scopId e.g. d2bq6a1. Some flexibility can be allowed in SCOP domain names, - * see {@link #setStrictSCOP(boolean)}
  • + *
  • To specify a SCOP domain write a scopId e.g. d2bq6a1.
  • *
  • URLs are accepted as well
  • * * @@ -670,14 +667,14 @@ public void setFileParsingParams(FileParsingParameters params) { * Load the requested ID from the PDB's obsolete repository *
  • {@link ObsoleteBehavior#FETCH_CURRENT FETCH_CURRENT} * Load the most recent version of the requested structure + * * *

    This setting may be silently ignored by implementations which do not have * access to the server to determine whether an entry is obsolete, such as - * if {@link #isAutoFetch()} is false. Note that an obsolete entry may still be + * certain {@link FetchBehavior}s. Note that an obsolete entry may still be * returned even this is FETCH_CURRENT if the entry is found locally. * - * @param fetchFileEvenIfObsolete Whether to fetch obsolete records - * @see #setFetchCurrent(boolean) + * @param behavior Whether to fetch obsolete records * @since 4.0.0 */ public void setObsoleteBehavior(ObsoleteBehavior behavior) { @@ -687,7 +684,7 @@ public void setObsoleteBehavior(ObsoleteBehavior behavior) { /** * Returns how this instance deals with obsolete entries. Note that this * setting may be ignored by some implementations or in some situations, - * such as when {@link #isAutoFetch()} is false. + * such as certain {@link FetchBehavior}s. * *

    For most implementations, the default value is * {@link ObsoleteBehavior#THROW_EXCEPTION THROW_EXCEPTION}. @@ -791,7 +788,7 @@ protected void flagLoadingFinished(PdbId pdbId) { /** * Loads a structure directly by PDB ID - * @param pdbId + * @param id * @return * @throws IOException * @throws StructureException @@ -806,12 +803,11 @@ public Structure getStructureForPdbId(String id) throws IOException, StructureEx * @param pdbId * @return * @throws IOException - * @throws StructureException */ public Structure getStructureForPdbId(PdbId pdbId) throws IOException { if (pdbId == null) return null; - + while (checkLoading(pdbId)) { // waiting for loading to be finished... try { @@ -837,7 +833,7 @@ public Structure getStructureForPdbId(PdbId pdbId) throws IOException { protected Structure loadStructureFromCifByPdbId(String pdbId) throws IOException { return loadStructureFromCifByPdbId(new PdbId(pdbId)); } - + protected Structure loadStructureFromCifByPdbId(PdbId pdbId) throws IOException { logger.debug("Loading structure {} from mmCIF file {}.", pdbId, path); Structure s; diff --git a/biojava-structure/src/main/java/org/biojava/nbio/structure/align/util/RotationAxis.java b/biojava-structure/src/main/java/org/biojava/nbio/structure/align/util/RotationAxis.java index 6e00e1d434..859f944645 100644 --- a/biojava-structure/src/main/java/org/biojava/nbio/structure/align/util/RotationAxis.java +++ b/biojava-structure/src/main/java/org/biojava/nbio/structure/align/util/RotationAxis.java @@ -374,8 +374,7 @@ private void calculateTranslationalAxis(Matrix rotation, Atom translation) { * @param atoms Some atoms from the protein, used for determining the bounds * of the axis. * - * @return The Jmol script, suitable for calls to - * {@link org.biojava.nbio.structure.align.gui.jmol.StructureAlignmentJmol#evalString() jmol.evalString()} + * @return The Jmol script */ public String getJmolScript(Atom[] atoms){ return getJmolScript(atoms, 0); @@ -442,8 +441,7 @@ public Pair getAxisEnds(Atom[] atoms) { * @param axisID in case of representing more than one axis in the same jmol * panel, indicate the ID number. * - * @return The Jmol script, suitable for calls to - * {@link org.biojava.nbio.structure.align.gui.jmol.StructureAlignmentJmol#evalString() jmol.evalString()} + * @return The Jmol script */ public String getJmolScript(Atom[] atoms, int axisID){ final double width=.5;// width of JMol object diff --git a/biojava-structure/src/main/java/org/biojava/nbio/structure/align/util/UserConfiguration.java b/biojava-structure/src/main/java/org/biojava/nbio/structure/align/util/UserConfiguration.java index 70e85acec3..67eba4c966 100644 --- a/biojava-structure/src/main/java/org/biojava/nbio/structure/align/util/UserConfiguration.java +++ b/biojava-structure/src/main/java/org/biojava/nbio/structure/align/util/UserConfiguration.java @@ -306,7 +306,6 @@ public XMLWriter toXML(PrintWriter pw) * @param xw the XML writer to use * @return the writer again * @throws IOException - * @see org.biojava.nbio.structure.align.webstart.ConfigXMLHandler */ public XMLWriter toXML(XMLWriter xw) diff --git a/biojava-structure/src/main/java/org/biojava/nbio/structure/asa/AsaCalculator.java b/biojava-structure/src/main/java/org/biojava/nbio/structure/asa/AsaCalculator.java index 956bbe90a4..0f46b7f416 100644 --- a/biojava-structure/src/main/java/org/biojava/nbio/structure/asa/AsaCalculator.java +++ b/biojava-structure/src/main/java/org/biojava/nbio/structure/asa/AsaCalculator.java @@ -126,16 +126,17 @@ static class IndexAndDistance { * Constructs a new AsaCalculator. Subsequently call {@link #calculateAsas()} * or {@link #getGroupAsas()} to calculate the ASAs * Only non-Hydrogen atoms are considered in the calculation. - * @param structure the structure, all non-H atoms will be used + * @param structure the structure, all non-H atoms of given model number will be used * @param probe the probe size * @param nSpherePoints the number of points to be used in generating the spherical * dot-density, the more points the more accurate (and slower) calculation * @param nThreads the number of parallel threads to use for the calculation * @param hetAtoms if true HET residues are considered, if false they aren't, equivalent to + * @param modelNr the model number from which we want atoms extracted * NACCESS' -h option */ - public AsaCalculator(Structure structure, double probe, int nSpherePoints, int nThreads, boolean hetAtoms) { - this.atoms = StructureTools.getAllNonHAtomArray(structure, hetAtoms); + public AsaCalculator(Structure structure, double probe, int nSpherePoints, int nThreads, boolean hetAtoms, int modelNr) { + this.atoms = StructureTools.getAllNonHAtomArray(structure, hetAtoms, modelNr); this.atomCoords = Calc.atomsToPoints(atoms); this.probe = probe; this.nThreads = nThreads; @@ -151,6 +152,22 @@ public AsaCalculator(Structure structure, double probe, int nSpherePoints, int n initSpherePoints(nSpherePoints); } + /** + * Constructs a new AsaCalculator. Subsequently call {@link #calculateAsas()} + * or {@link #getGroupAsas()} to calculate the ASAs + * Only non-Hydrogen atoms are considered in the calculation. + * @param structure the structure, all non-H atoms of model 1 will be used + * @param probe the probe size + * @param nSpherePoints the number of points to be used in generating the spherical + * dot-density, the more points the more accurate (and slower) calculation + * @param nThreads the number of parallel threads to use for the calculation + * @param hetAtoms if true HET residues are considered, if false they aren't, equivalent to + * NACCESS' -h option + */ + public AsaCalculator(Structure structure, double probe, int nSpherePoints, int nThreads, boolean hetAtoms) { + this(structure, probe, nSpherePoints, nThreads, hetAtoms, 0); + } + /** * Constructs a new AsaCalculator. Subsequently call {@link #calculateAsas()} * or {@link #getGroupAsas()} to calculate the ASAs. @@ -618,7 +635,7 @@ private static double getRadiusForNucl(NucleotideImpl nuc, Atom atom) { * * If atom is neither part of a nucleotide nor of a standard aminoacid, * the default vdw radius for the element is returned. If atom is of - * unknown type (element) the vdw radius of {@link Element().N} is returned + * unknown type (element) the vdw radius of {@link Element#N} is returned * * @param atom * @return diff --git a/biojava-structure/src/main/java/org/biojava/nbio/structure/chem/DownloadChemCompProvider.java b/biojava-structure/src/main/java/org/biojava/nbio/structure/chem/DownloadChemCompProvider.java index 5e0a055a39..9eb9c7c6cf 100644 --- a/biojava-structure/src/main/java/org/biojava/nbio/structure/chem/DownloadChemCompProvider.java +++ b/biojava-structure/src/main/java/org/biojava/nbio/structure/chem/DownloadChemCompProvider.java @@ -109,11 +109,13 @@ public static void setServerBaseUrl(String serverBaseUrl) { /** * Set the path to append to the serverBaseUrl (settable in {@link #setServerBaseUrl(String)}). * The string can contain placeholders that will be expanded at runtime: + *

      *
    • "{ccd_id}" to be replaced by the chemical component identifier, in capitals
    • *
    • "{ccd_id:beginIndex-endIndex}" to be replaced by a substring of the chemical component identifier in capitals, * with indices following the same convention as {@link String#substring(int, int)}
    • *
    • "{ccd_id:index}" to be replaced by a substring of the chemical component identifier in capitals, * with index either a positive or negative integer to substring from left or right of the string respectively.
    • + *
    * If any of the indices are off-bounds, then the full chemical component identifier is replaced */ public static void setChemCompPathUrlTemplate(String chemCompPathUrlTemplate) { diff --git a/biojava-structure/src/main/java/org/biojava/nbio/structure/chem/PolymerType.java b/biojava-structure/src/main/java/org/biojava/nbio/structure/chem/PolymerType.java index 78bae77f86..8066044a43 100644 --- a/biojava-structure/src/main/java/org/biojava/nbio/structure/chem/PolymerType.java +++ b/biojava-structure/src/main/java/org/biojava/nbio/structure/chem/PolymerType.java @@ -106,22 +106,22 @@ public static PolymerType polymerTypeFromString(String polymerTypeString) { } /** - * Convenience Set of polymer types classified as protein. This only contains {@link #peptide} + * Convenience Set of polymer types classified as protein. This only contains {@link #peptide} */ public static final Set PROTEIN_ONLY; /** - * Convenience Set of polymer types classified as DNA. This only contains {@link #dna} + * Convenience Set of polymer types classified as DNA. This only contains {@link #dna} */ public static final Set DNA_ONLY; /** - * Convenience Set of polymer types classified as RNA. This only contains {@link #rna} + * Convenience Set of polymer types classified as RNA. This only contains {@link #rna} */ public static final Set RNA_ONLY; /** - * Convenience Set of polymer types classified as DNA. This contains: + * Convenience Set of polymer types classified as DNA. This contains: *
      *
    • {@link #dna}
    • *
    • {@link #rna}
    • @@ -131,7 +131,7 @@ public static PolymerType polymerTypeFromString(String polymerTypeString) { public static final Set POLYNUCLEOTIDE_ONLY; /** - * Convenience Set of all polymer types. + * Convenience Set of all polymer types. */ public static final Set ALL_POLYMER_TYPES; diff --git a/biojava-structure/src/main/java/org/biojava/nbio/structure/chem/ZipChemCompProvider.java b/biojava-structure/src/main/java/org/biojava/nbio/structure/chem/ZipChemCompProvider.java index 4fe19aca58..a68019efb7 100644 --- a/biojava-structure/src/main/java/org/biojava/nbio/structure/chem/ZipChemCompProvider.java +++ b/biojava-structure/src/main/java/org/biojava/nbio/structure/chem/ZipChemCompProvider.java @@ -120,7 +120,7 @@ public ChemComp getChemComp(String recordName) { } // If a null record or an empty chemcomp, return a default ChemComp and blacklist. - if (cc == null || (null == cc.getName() && cc.getAtoms().size() == 0)) { + if (cc == null || (null == cc.getName() && cc.getAtoms().isEmpty())) { s_logger.info("Unable to find or download {} - excluding from future searches.", recordName); unavailable.add(recordName); return getEmptyChemComp(recordName); diff --git a/biojava-structure/src/main/java/org/biojava/nbio/structure/cluster/SubunitCluster.java b/biojava-structure/src/main/java/org/biojava/nbio/structure/cluster/SubunitCluster.java index 7851b8dbf3..87c3c06e3c 100644 --- a/biojava-structure/src/main/java/org/biojava/nbio/structure/cluster/SubunitCluster.java +++ b/biojava-structure/src/main/java/org/biojava/nbio/structure/cluster/SubunitCluster.java @@ -158,6 +158,22 @@ public SubunitCluster(SubunitCluster other, List subunitsToRetain) { setAlpha(other.getAlpha()); } + /** + * Create the cluster manually by specifying subunits and the equivalent residues + * @param subunits List of aligned subunits + * @param subunitEQR Double list giving the aligned residue indices in each subunit + */ + public SubunitCluster(List subunits, List> subunitEQR) { + if(subunits.size() != subunitEQR.size()) { + throw new IllegalArgumentException("Mismatched subunit length"); + } + this.subunits = subunits; + this.subunitEQR = subunitEQR; + this.representative = 0; + this.method = SubunitClustererMethod.MANUAL; + this.pseudoStoichiometric = false; + } + /** * Subunits contained in the SubunitCluster. * @@ -315,7 +331,7 @@ public boolean mergeIdenticalByEntityId(SubunitCluster other) { } } - if (thisAligned.size() == 0 && otherAligned.size() == 0) { + if (thisAligned.isEmpty() && otherAligned.isEmpty()) { logger.warn("No equivalent aligned atoms found between SubunitClusters {}-{} via entity SEQRES alignment. Is FileParsingParameters.setAlignSeqRes() set?", thisName, otherName); } @@ -491,21 +507,24 @@ public boolean mergeStructure(SubunitCluster other, SubunitClustererParameters p } } - AFPChain afp = aligner.align(this.subunits.get(this.representative) - .getRepresentativeAtoms(), - other.subunits.get(other.representative) - .getRepresentativeAtoms()); + AFPChain afp = aligner.align(this.subunits.get(this.representative).getRepresentativeAtoms(), + other.subunits.get(other.representative).getRepresentativeAtoms()); + + String pairName = this.subunits.get(this.representative).getName() + "-" + other.subunits.get(other.representative).getName(); + if (afp.getOptLength() < 1) { + // alignment failed (eg if chains were too short) + throw new StructureException( + String.format("Subunits %s failed to align using %s", pairName, params.getSuperpositionAlgorithm())); + } // Convert AFPChain to MultipleAlignment for convenience MultipleAlignment msa = new MultipleAlignmentEnsembleImpl( afp, this.subunits.get(this.representative).getRepresentativeAtoms(), - other.subunits.get(other.representative) - .getRepresentativeAtoms(), false) - .getMultipleAlignment(0); + other.subunits.get(other.representative).getRepresentativeAtoms(), + false).getMultipleAlignment(0); - double structureCoverage = Math.min(msa.getCoverages().get(0), msa - .getCoverages().get(1)); + double structureCoverage = Math.min(msa.getCoverages().get(0), msa.getCoverages().get(1)); if(params.isUseStructureCoverage() && structureCoverage < params.getStructureCoverageThreshold()) { return false; @@ -521,8 +540,7 @@ public boolean mergeStructure(SubunitCluster other, SubunitClustererParameters p return false; } - logger.info(String.format("SubunitClusters are structurally similar with " - + "%.2f RMSD %.2f coverage", rmsd, structureCoverage)); + logger.info("SubunitClusters {} are structurally similar with [ {} ] RMSD and [ {} ] coverage", pairName, String.format("%.2f", rmsd), String.format("%.2f", structureCoverage)); // Merge clusters List> alignedRes = msa.getBlock(0).getAlignRes(); @@ -543,13 +561,18 @@ public boolean mergeStructure(SubunitCluster other, SubunitClustererParameters p // Only consider residues that are part of the SubunitCluster if (this.subunitEQR.get(this.representative).contains(thisIndex) - && other.subunitEQR.get(other.representative).contains( - otherIndex)) { + && other.subunitEQR.get(other.representative).contains(otherIndex)) { thisAligned.add(thisIndex); otherAligned.add(otherIndex); } } + // this can happen in very rare cases, e.g. 9y9z when merging E_1 into the cluster D_1, OM_1, Y_1 + if (thisAligned.isEmpty() && otherAligned.isEmpty()) { + logger.warn("No equivalent aligned atoms found between SubunitClusters {} via structure alignment. Will not merge the second one into the first.", pairName); + return false; + } + updateEquivResidues(other, thisAligned, otherAligned); this.method = SubunitClustererMethod.STRUCTURE; @@ -580,18 +603,12 @@ private void updateEquivResidues(SubunitCluster other, List thisAligned Collections.sort(otherRemove); Collections.reverse(otherRemove); - for (int t = 0; t < thisRemove.size(); t++) { - for (List eqr : this.subunitEQR) { - int column = thisRemove.get(t); - eqr.remove(column); - } + for (int column : thisRemove) { + this.subunitEQR.forEach(eqr -> eqr.remove(column)); } - for (int t = 0; t < otherRemove.size(); t++) { - for (List eqr : other.subunitEQR) { - int column = otherRemove.get(t); - eqr.remove(column); - } + for (int column : otherRemove) { + other.subunitEQR.forEach(eqr -> eqr.remove(column)); } // The representative is the longest sequence diff --git a/biojava-structure/src/main/java/org/biojava/nbio/structure/cluster/SubunitClusterer.java b/biojava-structure/src/main/java/org/biojava/nbio/structure/cluster/SubunitClusterer.java index 6295f8fdf0..fa63b96d96 100644 --- a/biojava-structure/src/main/java/org/biojava/nbio/structure/cluster/SubunitClusterer.java +++ b/biojava-structure/src/main/java/org/biojava/nbio/structure/cluster/SubunitClusterer.java @@ -58,7 +58,7 @@ public static Stoichiometry cluster(Structure structure, public static Stoichiometry cluster(List subunits, SubunitClustererParameters params) { List clusters = new ArrayList<>(); - if (subunits.size() == 0) + if (subunits.isEmpty()) return new Stoichiometry(clusters); // First generate a new cluster for each Subunit @@ -83,8 +83,7 @@ public static Stoichiometry cluster(List subunits, SubunitClustererPara } } catch (CompoundNotFoundException e) { - logger.warn("Could not merge by Sequence. {}", - e.getMessage()); + logger.info("Could not merge by Sequence. {}", e.getMessage()); } } } @@ -100,7 +99,7 @@ public static Stoichiometry cluster(List subunits, SubunitClustererPara clusters.remove(c2); } } catch (StructureException e) { - logger.warn("Could not merge by Structure. {}", e.getMessage()); + logger.info("Could not merge by Structure. {}", e.getMessage()); } } } @@ -112,8 +111,7 @@ public static Stoichiometry cluster(List subunits, SubunitClustererPara try { clusters.get(c).divideInternally(params); } catch (StructureException e) { - logger.warn("Error analyzing internal symmetry. {}", - e.getMessage()); + logger.info("Error analyzing internal symmetry. {}", e.getMessage()); } } @@ -125,8 +123,7 @@ public static Stoichiometry cluster(List subunits, SubunitClustererPara if (clusters.get(c1).mergeStructure(clusters.get(c2), params)) clusters.remove(c2); } catch (StructureException e) { - logger.warn("Could not merge by Structure. {}", - e.getMessage()); + logger.info("Could not merge by Structure. {}", e.getMessage()); } } } diff --git a/biojava-structure/src/main/java/org/biojava/nbio/structure/cluster/SubunitClustererMethod.java b/biojava-structure/src/main/java/org/biojava/nbio/structure/cluster/SubunitClustererMethod.java index 40cd9fba6a..cd36611259 100644 --- a/biojava-structure/src/main/java/org/biojava/nbio/structure/cluster/SubunitClustererMethod.java +++ b/biojava-structure/src/main/java/org/biojava/nbio/structure/cluster/SubunitClustererMethod.java @@ -59,6 +59,10 @@ public enum SubunitClustererMethod { * sequence and structure clustering differ, the cluster contains * pseudosymmetry (by definition). */ - SEQUENCE_STRUCTURE -} + SEQUENCE_STRUCTURE, + /** + * Some other method was used when clustering. + */ + MANUAL, +} diff --git a/biojava-structure/src/main/java/org/biojava/nbio/structure/contact/GridCell.java b/biojava-structure/src/main/java/org/biojava/nbio/structure/contact/GridCell.java index 11e2a59283..6028110eb6 100644 --- a/biojava-structure/src/main/java/org/biojava/nbio/structure/contact/GridCell.java +++ b/biojava-structure/src/main/java/org/biojava/nbio/structure/contact/GridCell.java @@ -103,9 +103,6 @@ public List getContactsWithinCell(){ * within the given cutoff as a list of Contacts containing the indices of the pair and the calculated distance. * * @param otherCell - * @param iAtoms the first set of atom coordinates to which the iIndices correspond - * @param jAtoms the second set of atom coordinates to which the jIndices correspond, if null distances are within the iAtoms only - * @param cutoff * @return */ public List getContactsToOtherCell(GridCell otherCell){ diff --git a/biojava-structure/src/main/java/org/biojava/nbio/structure/contact/StructureInterfaceList.java b/biojava-structure/src/main/java/org/biojava/nbio/structure/contact/StructureInterfaceList.java index 5af5a61bc3..60f7c3a91b 100644 --- a/biojava-structure/src/main/java/org/biojava/nbio/structure/contact/StructureInterfaceList.java +++ b/biojava-structure/src/main/java/org/biojava/nbio/structure/contact/StructureInterfaceList.java @@ -52,7 +52,7 @@ public class StructureInterfaceList implements Serializable, Iterable * Citations: *

      - * Liu P, Agrafiotis DK, & Theobald DL (2011) Reply to comment on: "Fast + * Liu P, Agrafiotis DK, & Theobald DL (2011) Reply to comment on: "Fast * determination of the optimal rotation matrix for macromolecular * superpositions." Journal of Computational Chemistry 32(1):185-186. * [http://dx.doi.org/10.1002/jcc.21606] *

      - * Liu P, Agrafiotis DK, & Theobald DL (2010) "Fast determination of the optimal + * Liu P, Agrafiotis DK, & Theobald DL (2010) "Fast determination of the optimal * rotation matrix for macromolecular superpositions." Journal of Computational * Chemistry 31(7):1561-1563. [http://dx.doi.org/10.1002/jcc.21439] *

      @@ -96,7 +96,7 @@ *

      * dtheobald@brandeis.edu *

      - * Pu Liu Johnson & Johnson Pharmaceutical Research and Development, L.L.C. 665 + * Pu Liu Johnson & Johnson Pharmaceutical Research and Development, L.L.C. 665 * Stockton Drive Exton, PA 19341 USA *

      * pliu24@its.jnj.com @@ -587,7 +587,7 @@ public Matrix4d superpose(Point3d[] fixed, Point3d[] moved) { * @param fixed * @param moved * @param weight - * array of weigths for each equivalent point position + * array of weights for each equivalent point position * @return weighted RMSD. */ public double getWeightedRmsd(Point3d[] fixed, Point3d[] moved, double[] weight) { @@ -598,13 +598,11 @@ public double getWeightedRmsd(Point3d[] fixed, Point3d[] moved, double[] weight) /** * The QCP method can be used as a two-step calculation: first compute the * RMSD (fast) and then compute the superposition. - * + *

      * This method assumes that the RMSD of two arrays of points has been * already calculated using {@link #getRmsd(Point3d[], Point3d[])} method * and calculates the transformation of the same two point arrays. * - * @param fixed - * @param moved * @return transformation matrix as a Matrix4d to superpose moved onto fixed * point arrays */ diff --git a/biojava-structure/src/main/java/org/biojava/nbio/structure/io/BondMaker.java b/biojava-structure/src/main/java/org/biojava/nbio/structure/io/BondMaker.java index a582f922d2..e6b8548025 100644 --- a/biojava-structure/src/main/java/org/biojava/nbio/structure/io/BondMaker.java +++ b/biojava-structure/src/main/java/org/biojava/nbio/structure/io/BondMaker.java @@ -89,6 +89,7 @@ public BondMaker(Structure structure, FileParsingParameters params) { /** * Creates bond objects and corresponding references in Atom objects: + *

        *
      • * peptide bonds: inferred from sequence and distances *
      • @@ -98,6 +99,7 @@ public BondMaker(Structure structure, FileParsingParameters params) { *
      • * intra-group (residue) bonds: read from the chemical component dictionary, via {@link org.biojava.nbio.structure.chem.ChemCompProvider} *
      • + *
      */ public void makeBonds() { logger.debug("Going to start making bonds"); diff --git a/biojava-structure/src/main/java/org/biojava/nbio/structure/io/FastaAFPChainConverter.java b/biojava-structure/src/main/java/org/biojava/nbio/structure/io/FastaAFPChainConverter.java index 81bf601ab6..1b8278125e 100644 --- a/biojava-structure/src/main/java/org/biojava/nbio/structure/io/FastaAFPChainConverter.java +++ b/biojava-structure/src/main/java/org/biojava/nbio/structure/io/FastaAFPChainConverter.java @@ -51,7 +51,7 @@ import java.util.*; /** - * A collection of static utilities to convert between {@link AFPChain AFPChains} and {@link FastaSequence FastaSequences}. + * A collection of static utilities to convert between {@link AFPChain AFPChains} and FastaSequences. * * @author dmyersturnbull * @see StructureSequenceMatcher @@ -73,7 +73,7 @@ public static AFPChain cpFastaToAfpChain(String first, String second, Structure /** * Takes a structure and sequence corresponding to an alignment between a structure or sequence and itself (or even a structure with a sequence), where the result has a circular permutation site - * {@link cpSite} residues to the right. + * cpSite residues to the right. * * @param fastaFile A FASTA file containing exactly 2 sequences, the first unpermuted and the second permuted * @param cpSite @@ -97,7 +97,7 @@ public static AFPChain cpFastaToAfpChain(File fastaFile, Structure structure, in /** * Takes a structure and sequence corresponding to an alignment between a structure or sequence and itself (or even a structure with a sequence), where the result has a circular permutation site - * {@link cpSite} residues to the right. + * cpSite residues to the right. * * @param first The unpermuted sequence * @param second The sequence permuted by cpSite diff --git a/biojava-structure/src/main/java/org/biojava/nbio/structure/io/LocalPDBDirectory.java b/biojava-structure/src/main/java/org/biojava/nbio/structure/io/LocalPDBDirectory.java index 5297443a34..4ec4577f59 100644 --- a/biojava-structure/src/main/java/org/biojava/nbio/structure/io/LocalPDBDirectory.java +++ b/biojava-structure/src/main/java/org/biojava/nbio/structure/io/LocalPDBDirectory.java @@ -259,10 +259,10 @@ public FileParsingParameters getFileParsingParameters(){ * Load the requested ID from the PDB's obsolete repository *
    • {@link ObsoleteBehavior#FETCH_CURRENT FETCH_CURRENT} * Load the most recent version of the requested structure - * + *
    *

    This setting may be silently ignored by implementations which do not have * access to the server to determine whether an entry is obsolete, such as - * if {@link #isAutoFetch()} is false. Note that an obsolete entry may still be + * certain {@link FetchBehavior}s. Note that an obsolete entry may still be * returned even this is FETCH_CURRENT if the entry is found locally. * * @param behavior Whether to fetch obsolete records @@ -276,7 +276,7 @@ public void setObsoleteBehavior(ObsoleteBehavior behavior) { /** * Returns how this instance deals with obsolete entries. Note that this * setting may be ignored by some implementations or in some situations, - * such as when {@link #isAutoFetch()} is false. + * such as certain {@link FetchBehavior}s. * *

    For most implementations, the default value is * {@link ObsoleteBehavior#THROW_EXCEPTION THROW_EXCEPTION}. @@ -295,10 +295,9 @@ public ObsoleteBehavior getObsoleteBehavior() { public FetchBehavior getFetchBehavior() { return fetchBehavior; } + /** * Set the behavior for fetching files from the server. - * This replaces the {@link #setAutoFetch(boolean)} method with a more - * extensive set of options. * @param fetchBehavior */ public void setFetchBehavior(FetchBehavior fetchBehavior) { diff --git a/biojava-structure/src/main/java/org/biojava/nbio/structure/io/PDBFileParser.java b/biojava-structure/src/main/java/org/biojava/nbio/structure/io/PDBFileParser.java index 176459bbf2..58e4ee6625 100644 --- a/biojava-structure/src/main/java/org/biojava/nbio/structure/io/PDBFileParser.java +++ b/biojava-structure/src/main/java/org/biojava/nbio/structure/io/PDBFileParser.java @@ -1970,7 +1970,7 @@ private Group getCorrectAltLocGroup( Character altLoc, // build it up. if ( groupCode3.equals(currentGroup.getPDBName())) { - if ( currentGroup.getAtoms().size() == 0) { + if ( currentGroup.getAtoms().isEmpty()) { //System.out.println("current group is empty " + current_group + " " + altLoc); return currentGroup; } @@ -2762,7 +2762,7 @@ private void makeCompounds(List compoundList, } // System.out.println("[makeCompounds] adding sources to compounds from sourceLines"); // since we're starting again from the first compound, reset it here - if ( entities.size() == 0){ + if ( entities.isEmpty()){ current_compound = new EntityInfo(); } else { current_compound = entities.get(0); diff --git a/biojava-structure/src/main/java/org/biojava/nbio/structure/io/PDBFileReader.java b/biojava-structure/src/main/java/org/biojava/nbio/structure/io/PDBFileReader.java index 5591fbdd84..dec97b4f61 100644 --- a/biojava-structure/src/main/java/org/biojava/nbio/structure/io/PDBFileReader.java +++ b/biojava-structure/src/main/java/org/biojava/nbio/structure/io/PDBFileReader.java @@ -30,27 +30,17 @@ import java.io.InputStream; /** - *

    * The wrapper class for parsing a PDB file. - *

    - * * - *

    + *

    * Several flags can be set for this class - *

      - * - *
    • {@link #setAutoFetch(boolean)} - if the PDB file can not be found locally, should it be fetched - * from the PDB ftp servers? (default:false)
    • - *
    • Other parameters can be set using the {@link #setFileParsingParameters(FileParsingParameters)}
    • - *
    - *

    - * - * + *
      + *
    • Parameters can be set using the {@link #setFileParsingParameters(FileParsingParameters)}
    • + *
    * *

    Example

    *

    * Q: How can I get a Structure object from a PDB file? - *

    *

    * A: *

    diff --git a/biojava-structure/src/main/java/org/biojava/nbio/structure/io/StructureSequenceMatcher.java b/biojava-structure/src/main/java/org/biojava/nbio/structure/io/StructureSequenceMatcher.java
    index fd06080118..529526e2e0 100644
    --- a/biojava-structure/src/main/java/org/biojava/nbio/structure/io/StructureSequenceMatcher.java
    +++ b/biojava-structure/src/main/java/org/biojava/nbio/structure/io/StructureSequenceMatcher.java
    @@ -59,8 +59,7 @@ public class StructureSequenceMatcher {
     	 * @param sequence The input protein sequence
     	 * @param wholeStructure The structure from which to take a substructure
     	 * @return The resulting structure
    -	 * @throws StructureException
    -	 * @see {@link #matchSequenceToStructure(ProteinSequence, Structure)}
    +	 * @see #matchSequenceToStructure(ProteinSequence, Structure)
     	 */
     	public static Structure getSubstructureMatchingProteinSequence(ProteinSequence sequence, Structure wholeStructure) {
     		ResidueNumber[] rns = matchSequenceToStructure(sequence, wholeStructure);
    @@ -104,8 +103,7 @@ public static Structure getSubstructureMatchingProteinSequence(ProteinSequence s
     	 * @return A ProteinSequence with the full sequence of struct. Chains are
     	 *  concatenated in the same order as the input structures
     	 *
    -	 * @see {@link SeqRes2AtomAligner#getFullAtomSequence(List, Map)}, which
    -	 * 	does the heavy lifting.
    +	 * @see SeqRes2AtomAligner#getFullAtomSequence(List, Map, boolean)
     	 *
     	 */
     	public static ProteinSequence getProteinSequenceForStructure(Structure struct, Map groupIndexPosition ) {
    diff --git a/biojava-structure/src/main/java/org/biojava/nbio/structure/io/cif/AbstractCifFileSupplier.java b/biojava-structure/src/main/java/org/biojava/nbio/structure/io/cif/AbstractCifFileSupplier.java
    index 826d9588ef..7e9d8ad7ac 100644
    --- a/biojava-structure/src/main/java/org/biojava/nbio/structure/io/cif/AbstractCifFileSupplier.java
    +++ b/biojava-structure/src/main/java/org/biojava/nbio/structure/io/cif/AbstractCifFileSupplier.java
    @@ -308,7 +308,12 @@ public void accept(WrappedAtom wrappedAtom) {
                     }
                 }
                 labelEntityId.add(entityId);
    -            labelSeqId.add(seqId);
    +            // see https://github.com/biojava/biojava/issues/1116
    +            if (chain.getEntityInfo().getType() == EntityType.POLYMER) {
    +                labelSeqId.add(seqId);
    +            } else {
    +                labelSeqId.markNextNotPresent();
    +            }
                 String insCode = "";
                 if (group.getResidueNumber().getInsCode() != null) {
                     insCode = Character.toString(group.getResidueNumber().getInsCode());
    diff --git a/biojava-structure/src/main/java/org/biojava/nbio/structure/io/cif/CifStructureConsumerImpl.java b/biojava-structure/src/main/java/org/biojava/nbio/structure/io/cif/CifStructureConsumerImpl.java
    index ca3906e4b2..67514edd84 100644
    --- a/biojava-structure/src/main/java/org/biojava/nbio/structure/io/cif/CifStructureConsumerImpl.java
    +++ b/biojava-structure/src/main/java/org/biojava/nbio/structure/io/cif/CifStructureConsumerImpl.java
    @@ -333,7 +333,7 @@ public void consumeAtomSite(AtomSite atomSite) {
                 atom.setY(cartnY.get(atomIndex));
                 atom.setZ(cartnZ.get(atomIndex));
     
    -            atom.setOccupancy((float) occupancy.get(atomIndex));
    +            atom.setOccupancy((float) (occupancy.isDefined()? occupancy.get(atomIndex) : 1.0));
                 atom.setTempFactor((float) bIsoOrEquiv.get(atomIndex));
     
                 if (altLocation == null || altLocation.isEmpty() || ".".equals(altLocation)) {
    @@ -972,10 +972,10 @@ public void consumeStructRefSeq(StructRefSeq structRefSeq) {
     
                 DBRef dbRef = new DBRef();
     
    -            dbRef.setIdCode(structRefSeq.getPdbxPDBIdCode().get(rowIndex));
    -            dbRef.setDbAccession(structRefSeq.getPdbxDbAccession().get(rowIndex));
    -            dbRef.setDbIdCode(structRefSeq.getPdbxDbAccession().get(rowIndex));
    -            dbRef.setChainName(structRefSeq.getPdbxStrandId().get(rowIndex));
    +            dbRef.setIdCode(structRefSeq.getPdbxPDBIdCode().isDefined()? structRefSeq.getPdbxPDBIdCode().get(rowIndex):null);
    +            dbRef.setDbAccession(structRefSeq.getPdbxDbAccession().isDefined()? structRefSeq.getPdbxDbAccession().get(rowIndex):null);
    +            dbRef.setDbIdCode(structRefSeq.getPdbxDbAccession().isDefined()? structRefSeq.getPdbxDbAccession().get(rowIndex):null);
    +            dbRef.setChainName(structRefSeq.getPdbxStrandId().isDefined()? structRefSeq.getPdbxStrandId().get(rowIndex):null);
     
                 OptionalInt structRefRowIndex = IntStream.range(0, structRef.getRowCount())
                         .filter(i -> structRef.getId().get(i).equals(refId))
    @@ -990,34 +990,39 @@ public void consumeStructRefSeq(StructRefSeq structRefSeq) {
     
                 int seqBegin;
                 int seqEnd;
    +            char beginInsCode = ' ';
    +            char endInsCode = ' ';
     
    -            try {
    -                seqBegin = Integer.parseInt(structRefSeq.getPdbxAuthSeqAlignBeg().get(rowIndex));
    -                seqEnd = Integer.parseInt(structRefSeq.getPdbxAuthSeqAlignEnd().get(rowIndex));
    -            } catch (NumberFormatException e) {
    -                // this happens in a few entries, annotation error? e.g. 6eoj
    -                logger.warn("Couldn't parse pdbx_auth_seq_align_beg/end in _struct_ref_seq. Will not store dbref " +
    -                        "alignment info for accession {}. Error: {}", dbRef.getDbAccession(), e.getMessage());
    -                return;
    -            }
    +            if (structRefSeq.getPdbxAuthSeqAlignBeg().isDefined() && structRefSeq.getPdbxAuthSeqAlignEnd().isDefined()) {
    +                try {
    +                    seqBegin = Integer.parseInt(structRefSeq.getPdbxAuthSeqAlignBeg().get(rowIndex));
    +                    seqEnd = Integer.parseInt(structRefSeq.getPdbxAuthSeqAlignEnd().get(rowIndex));
    +                } catch (NumberFormatException e) {
    +                    // this happens in a few entries, annotation error? e.g. 6eoj
    +                    logger.warn("Couldn't parse pdbx_auth_seq_align_beg/end in _struct_ref_seq. Will not store dbref " +
    +                            "alignment info for accession {}. Error: {}", dbRef.getDbAccession(), e.getMessage());
    +                    return;
    +                }
     
    -            char beginInsCode = ' ';
    -            String pdbxSeqAlignBegInsCode = structRefSeq.getPdbxSeqAlignBegInsCode().get(rowIndex);
    -            if (pdbxSeqAlignBegInsCode.length() > 0) {
    -                beginInsCode = pdbxSeqAlignBegInsCode.charAt(0);
    -            }
    +                String pdbxSeqAlignBegInsCode = structRefSeq.getPdbxSeqAlignBegInsCode().get(rowIndex);
    +                if (pdbxSeqAlignBegInsCode.length() > 0) {
    +                    beginInsCode = pdbxSeqAlignBegInsCode.charAt(0);
    +                }
     
    -            char endInsCode = ' ';
    -            String pdbxSeqAlignEndInsCode = structRefSeq.getPdbxSeqAlignEndInsCode().get(rowIndex);
    -            if (pdbxSeqAlignEndInsCode.length() > 0) {
    -                endInsCode = pdbxSeqAlignEndInsCode.charAt(0);
    -            }
    +                String pdbxSeqAlignEndInsCode = structRefSeq.getPdbxSeqAlignEndInsCode().get(rowIndex);
    +                if (pdbxSeqAlignEndInsCode.length() > 0) {
    +                    endInsCode = pdbxSeqAlignEndInsCode.charAt(0);
    +                }
     
    -            if (beginInsCode == '?') {
    -                beginInsCode = ' ';
    -            }
    -            if (endInsCode == '?') {
    -                endInsCode = ' ';
    +                if (beginInsCode == '?') {
    +                    beginInsCode = ' ';
    +                }
    +                if (endInsCode == '?') {
    +                    endInsCode = ' ';
    +                }
    +            } else {
    +                seqBegin = structRefSeq.getSeqAlignBeg().get(rowIndex);
    +                seqEnd = structRefSeq.getSeqAlignEnd().get(rowIndex);
                 }
     
                 dbRef.setSeqBegin(seqBegin);
    @@ -1156,7 +1161,7 @@ public void finish() {
                     currentModel.add(currentChain);
                 }
             } else if (!params.isHeaderOnly()) {
    -            logger.warn("current chain is null at end of document.");
    +            logger.warn("No chains were instantiated after parsing the whole CIF document. This could be due to the atom_site category being absent");
             }
     
             allModels.add(currentModel);
    @@ -1292,17 +1297,21 @@ public void finish() {
                 SeqMisMatch seqMisMatch = new SeqMisMatchImpl();
                 seqMisMatch.setDetails(structRefSeqDif.getDetails().get(rowIndex));
     
    -            String insCode = structRefSeqDif.getPdbxPdbInsCode().get(rowIndex);
    +            String insCode = null;
    +            if (structRefSeqDif.getPdbxPdbInsCode().isDefined()) {
    +                insCode = structRefSeqDif.getPdbxPdbInsCode().get(rowIndex);
                     if ("?".equals(insCode)) {
    -                insCode = null;
    +                    insCode = null;
    +                }
                 }
                 seqMisMatch.setInsCode(insCode);
                 seqMisMatch.setOrigGroup(structRefSeqDif.getDbMonId().get(rowIndex));
                 seqMisMatch.setPdbGroup(structRefSeqDif.getMonId().get(rowIndex));
    -            seqMisMatch.setPdbResNum(structRefSeqDif.getPdbxAuthSeqNum().get(rowIndex));
    -            seqMisMatch.setUniProtId(structRefSeqDif.getPdbxSeqDbAccessionCode().get(rowIndex));
    +            seqMisMatch.setPdbResNum(structRefSeqDif.getPdbxAuthSeqNum().isDefined()? structRefSeqDif.getPdbxAuthSeqNum().get(rowIndex):null);
    +            seqMisMatch.setUniProtId(structRefSeqDif.getPdbxSeqDbAccessionCode().isDefined()? structRefSeqDif.getPdbxSeqDbAccessionCode().get(rowIndex):null);
                 seqMisMatch.setSeqNum(structRefSeqDif.getSeqNum().get(rowIndex));
     
    +            if (!structRefSeqDif.getPdbxPdbStrandId().isDefined()) continue;
                 String strandId = structRefSeqDif.getPdbxPdbStrandId().get(rowIndex);
                 List seqMisMatches = misMatchMap.computeIfAbsent(strandId, k -> new ArrayList<>());
                 seqMisMatches.add(seqMisMatch);
    @@ -1330,7 +1339,7 @@ private String getEntityType(String entityId) {
         private String getEntityDescription(String entityId) {
             return IntStream.range(0, entity.getRowCount())
                     .filter(i -> entity.getId().get(i).equals(entityId))
    -                .mapToObj(i -> entity.getPdbxDescription().get(i))
    +                .mapToObj(i -> entity.getPdbxDescription().isDefined()? entity.getPdbxDescription().get(i):"")
                     .findFirst()
                     .orElseThrow(() -> new NoSuchElementException("could not find entity with id " + entityId));
         }
    @@ -1814,6 +1823,10 @@ private void initMaps() {
     
                 String[] chainNames = entityPoly.getPdbxStrandId().get(rowIndex).split(",");
                 List asymIds = entityId2asymId.get(entityPoly.getEntityId().get(rowIndex));
    +            if (asymIds == null) {
    +                logger.warn("No asym ids found for entity {} in _struct_asym. Can't provide a mapping from asym ids to author chain ids for this entity", entityPoly.getEntityId().get(rowIndex));
    +                break;
    +            }
                 if (chainNames.length != asymIds.size()) {
                     logger.warn("The list of asym ids (from _struct_asym) and the list of author ids (from _entity_poly) " +
                             "for entity {} have different lengths! Can't provide a mapping from asym ids to author chain " +
    diff --git a/biojava-structure/src/main/java/org/biojava/nbio/structure/io/mmtf/MmtfStructureReader.java b/biojava-structure/src/main/java/org/biojava/nbio/structure/io/mmtf/MmtfStructureReader.java
    index c2830c1685..21ef8bb64c 100644
    --- a/biojava-structure/src/main/java/org/biojava/nbio/structure/io/mmtf/MmtfStructureReader.java
    +++ b/biojava-structure/src/main/java/org/biojava/nbio/structure/io/mmtf/MmtfStructureReader.java
    @@ -396,7 +396,7 @@ private Group getCorrectAltLocGroup(Character altLoc) {
     		}
     		// no matching altLoc group found.
     		// build it up.
    -		if (group.getAtoms().size() == 0) {
    +		if (group.getAtoms().isEmpty()) {
     			return group;
     		}
     		Group altLocG = (Group) group.clone();
    diff --git a/biojava-structure/src/main/java/org/biojava/nbio/structure/jama/LUDecomposition.java b/biojava-structure/src/main/java/org/biojava/nbio/structure/jama/LUDecomposition.java
    index 00f5d302ec..64c77c3665 100644
    --- a/biojava-structure/src/main/java/org/biojava/nbio/structure/jama/LUDecomposition.java
    +++ b/biojava-structure/src/main/java/org/biojava/nbio/structure/jama/LUDecomposition.java
    @@ -22,10 +22,10 @@
     
     	/** LU Decomposition.
     	

    - For an m-by-n matrix A with m >= n, the LU decomposition is an m-by-n + For an m-by-n matrix A with m >= n, the LU decomposition is an m-by-n unit lower triangular matrix L, an n-by-n upper triangular matrix U, and a permutation vector piv of length m so that A(piv,:) = L*U. - If m < n, then L is m-by-m and U is m-by-n. + If m < n, then L is m-by-m and U is m-by-n.

    The LU decompostion with pivoting always exists, even if the matrix is singular, so the constructor will never fail. The primary use of the diff --git a/biojava-structure/src/main/java/org/biojava/nbio/structure/jama/Matrix.java b/biojava-structure/src/main/java/org/biojava/nbio/structure/jama/Matrix.java index 15bd130b99..fab188ce98 100644 --- a/biojava-structure/src/main/java/org/biojava/nbio/structure/jama/Matrix.java +++ b/biojava-structure/src/main/java/org/biojava/nbio/structure/jama/Matrix.java @@ -53,7 +53,7 @@ * decomposition classes. These decompositions are accessed by the Matrix * class to compute solutions of simultaneous linear equations, determinants, * inverses and other matrix functions. The five decompositions are: - *

      + *
        *
      • Cholesky Decomposition of symmetric, positive definite matrices. *
      • LU Decomposition of rectangular matrices. *
      • QR Decomposition of rectangular matrices. @@ -62,7 +62,7 @@ *
      *
      *
      Example of use:
      - *

      + * *

      Solve a linear system A x = b and compute the residual norm, ||b - A x||. *

        * 		double[][] vals = {{1.,2.,3},{4.,5.,6.},{7.,8.,10.}};
      diff --git a/biojava-structure/src/main/java/org/biojava/nbio/structure/math/SymbolTable.java b/biojava-structure/src/main/java/org/biojava/nbio/structure/math/SymbolTable.java
      index 0f9066b323..960e18b019 100644
      --- a/biojava-structure/src/main/java/org/biojava/nbio/structure/math/SymbolTable.java
      +++ b/biojava-structure/src/main/java/org/biojava/nbio/structure/math/SymbolTable.java
      @@ -35,7 +35,7 @@
        *  Does not allow duplicate keys.
        *
        *  This class represents an ordered symbol table. It assumes that
      - *  the elements are Comparable.
      + *  the elements are Comparable.
        *  It supports the usual put, get, contains,
        *  and delete methods.
        *  It also provides ordered methods for finding the minimum,
      @@ -111,9 +111,9 @@ public int size() {
       	}
       
       	/**
      -	 * Return an Iterator for the keys in the table.
      -	 * To iterate over all of the keys in the symbol table st, use the
      -	 * foreach notation: for (Key key : st).
      +	 * Return an Iterator for the keys in the table.
      +	 * To iterate over all of the keys in the symbol table st, use the
      +	 * foreach notation: for (Key key : st).
       	 */
       	@Override
       	public Iterator iterator() {
      @@ -121,9 +121,9 @@ public Iterator iterator() {
       	}
       
       	/**
      -	 * Return an Iterable for the keys in the table.
      -	 * To iterate over all of the keys in the symbol table st, use the
      -	 * foreach notation: for (Key key : st.keys()).
      +	 * Return an Iterable for the keys in the table.
      +	 * To iterate over all of the keys in the symbol table st, use the
      +	 * foreach notation: for (Key key : st.keys()).
       	 */
       	public Iterable keys() {
       		return st.keySet();
      @@ -153,7 +153,7 @@ public Key ceil(Key k) {
       	}
       
       	/**
      -	 * Return the largest key in the table <= k.
      +	 * Return the largest key in the table <= k.
       	 */
       	public Key floor(Key k) {
       		if (st.containsKey(k)) return k;
      diff --git a/biojava-structure/src/main/java/org/biojava/nbio/structure/package-info.java b/biojava-structure/src/main/java/org/biojava/nbio/structure/package-info.java
      index fecc3afee6..8d5fb81573 100644
      --- a/biojava-structure/src/main/java/org/biojava/nbio/structure/package-info.java
      +++ b/biojava-structure/src/main/java/org/biojava/nbio/structure/package-info.java
      @@ -19,10 +19,8 @@
        *
        */
       /**
      - * 
      - * 

      * Interfaces and classes for protein structure (PDB). - *

      + * *

      * See also the BioJava 3 tutorial for more information on the protein structure modules. *

      @@ -62,8 +60,7 @@ * For more documentation on how to work with the Structure API please * see * http://biojava.org/wiki/BioJava:CookBook#Protein_Structure - *

      - * + * * @since 1.5 */ package org.biojava.nbio.structure; \ No newline at end of file diff --git a/biojava-structure/src/main/java/org/biojava/nbio/structure/quaternary/BioAssemblyTools.java b/biojava-structure/src/main/java/org/biojava/nbio/structure/quaternary/BioAssemblyTools.java index 95bcf1b402..8f76b2ae61 100644 --- a/biojava-structure/src/main/java/org/biojava/nbio/structure/quaternary/BioAssemblyTools.java +++ b/biojava-structure/src/main/java/org/biojava/nbio/structure/quaternary/BioAssemblyTools.java @@ -55,7 +55,7 @@ public static boolean isUnaryExpression(String expression) { if (first < 0 || last < 0) { return true; } - return ! (first == 0 && last > first); + return first != 0 || last <= first; } public static List parseUnaryOperatorExpression(String operatorExpression) { @@ -262,12 +262,11 @@ public static double getBiologicalMoleculeMaximumExtend( final Structure structu /** * Returns the centroid of the biological molecule. - * @param structure + * @param asymUnit * @return centroid * @throws IllegalArgumentException if structure is null */ - - public static double[] getBiologicalMoleculeCentroid( final Structure asymUnit,List transformations ) { + public static double[] getBiologicalMoleculeCentroid( final Structure asymUnit, List transformations ) { if ( asymUnit == null ) { throw new IllegalArgumentException( "null structure" ); } @@ -280,7 +279,7 @@ public static double[] getBiologicalMoleculeCentroid( final Structure asymUnit,L return centroid; } - if ( transformations.size() == 0) { + if ( transformations.isEmpty()) { return Calc.getCentroid(atoms).getCoords(); } diff --git a/biojava-structure/src/main/java/org/biojava/nbio/structure/quaternary/BiologicalAssemblyBuilder.java b/biojava-structure/src/main/java/org/biojava/nbio/structure/quaternary/BiologicalAssemblyBuilder.java index f9597bbb7d..9edb8f404c 100644 --- a/biojava-structure/src/main/java/org/biojava/nbio/structure/quaternary/BiologicalAssemblyBuilder.java +++ b/biojava-structure/src/main/java/org/biojava/nbio/structure/quaternary/BiologicalAssemblyBuilder.java @@ -75,6 +75,7 @@ public BiologicalAssemblyBuilder(){ * Builds a Structure object containing the quaternary structure built from given asymUnit and transformations, * by adding symmetry partners as new models. * The output Structure will be different depending on the multiModel parameter: + *
        *
      • * the symmetry-expanded chains are added as new models, one per transformId. All original models but * the first one are discarded. @@ -83,6 +84,7 @@ public BiologicalAssemblyBuilder(){ * as original with symmetry-expanded chains added with renamed chain ids and names (in the form * originalAsymId_transformId and originalAuthId_transformId) *
      • + *
      * @param asymUnit * @param transformations * @param useAsymIds if true use {@link Chain#getId()} to match the ids in the BiologicalAssemblyTransformation (needed if data read from mmCIF), @@ -203,7 +205,7 @@ private void addChainMultiModel(Structure s, Chain newChain, String transformId) // multi-model bioassembly - if ( modelIndex.size() == 0) + if (modelIndex.isEmpty()) modelIndex.add("PLACEHOLDER FOR ASYM UNIT"); int modelCount = modelIndex.indexOf(transformId); diff --git a/biojava-structure/src/main/java/org/biojava/nbio/structure/secstruc/BridgeType.java b/biojava-structure/src/main/java/org/biojava/nbio/structure/secstruc/BridgeType.java index 04e35fe14d..26b4656767 100644 --- a/biojava-structure/src/main/java/org/biojava/nbio/structure/secstruc/BridgeType.java +++ b/biojava-structure/src/main/java/org/biojava/nbio/structure/secstruc/BridgeType.java @@ -22,7 +22,7 @@ /** * A bridge is formed by two non-overlapping stretches of three residues each - * (i-1,i,i+1) and (j-1,j,j+1), where i * Depending on two basic patterns, a Bridge can be either of type parallel (H * bonds in {(i-1,j) and (j,i+1)} OR {(j-1,i) and (i,j-1)}) or antiparallel (H diff --git a/biojava-structure/src/main/java/org/biojava/nbio/structure/secstruc/SecStrucState.java b/biojava-structure/src/main/java/org/biojava/nbio/structure/secstruc/SecStrucState.java index 33bdc7c931..6faebae39c 100644 --- a/biojava-structure/src/main/java/org/biojava/nbio/structure/secstruc/SecStrucState.java +++ b/biojava-structure/src/main/java/org/biojava/nbio/structure/secstruc/SecStrucState.java @@ -107,7 +107,7 @@ public char[] getTurn() { /** * Set the turn column corresponding to 3,4 or 5 helix patterns. If starting - * > or ending < was set and the opposite is being set, the value will be + * > or ending < was set and the opposite is being set, the value will be * converted to X. If a number was set, it will be overwritten by the new * character. * diff --git a/biojava-structure/src/main/java/org/biojava/nbio/structure/secstruc/SecStrucTools.java b/biojava-structure/src/main/java/org/biojava/nbio/structure/secstruc/SecStrucTools.java index 7732c04b80..42191d682d 100644 --- a/biojava-structure/src/main/java/org/biojava/nbio/structure/secstruc/SecStrucTools.java +++ b/biojava-structure/src/main/java/org/biojava/nbio/structure/secstruc/SecStrucTools.java @@ -57,7 +57,7 @@ public static List getSecStrucInfo(Structure s) { Group g = iter.next(); if (g.hasAminoAtoms()) { Object p = g.getProperty(Group.SEC_STRUC); - if (!(p == null)) { + if (p != null) { SecStrucInfo ss = (SecStrucInfo) p; listSSI.add(ss); } diff --git a/biojava-structure/src/main/java/org/biojava/nbio/structure/symmetry/core/HelicalRepeatUnit.java b/biojava-structure/src/main/java/org/biojava/nbio/structure/symmetry/core/HelicalRepeatUnit.java index ff9c77cf13..cd16aa5f87 100644 --- a/biojava-structure/src/main/java/org/biojava/nbio/structure/symmetry/core/HelicalRepeatUnit.java +++ b/biojava-structure/src/main/java/org/biojava/nbio/structure/symmetry/core/HelicalRepeatUnit.java @@ -64,7 +64,7 @@ public Map getInteractingRepeatUnits() { private void run() { this.repeatUnitCenters = calcRepeatUnitCenters(); - if (this.repeatUnitCenters.size() == 0) { + if (this.repeatUnitCenters.isEmpty()) { return; } this.repeatUnits = calcRepeatUnits(); diff --git a/biojava-structure/src/main/java/org/biojava/nbio/structure/symmetry/core/Helix.java b/biojava-structure/src/main/java/org/biojava/nbio/structure/symmetry/core/Helix.java index 4dabe0c0ac..2c399185f1 100644 --- a/biojava-structure/src/main/java/org/biojava/nbio/structure/symmetry/core/Helix.java +++ b/biojava-structure/src/main/java/org/biojava/nbio/structure/symmetry/core/Helix.java @@ -101,7 +101,6 @@ public void setRise(double rise) { /** * Returns the pitch angle of the helix - * @param transformation helix transformation * @return */ public double getAngle() { @@ -110,7 +109,6 @@ public double getAngle() { /** * Returns the AxisAngle of the helix transformation - * @param transformation helix transformation * @return */ public AxisAngle4d getAxisAngle() { diff --git a/biojava-structure/src/main/java/org/biojava/nbio/structure/symmetry/core/QuatSuperpositionScorer.java b/biojava-structure/src/main/java/org/biojava/nbio/structure/symmetry/core/QuatSuperpositionScorer.java index 5df1278563..1964132a0d 100644 --- a/biojava-structure/src/main/java/org/biojava/nbio/structure/symmetry/core/QuatSuperpositionScorer.java +++ b/biojava-structure/src/main/java/org/biojava/nbio/structure/symmetry/core/QuatSuperpositionScorer.java @@ -40,7 +40,7 @@ public class QuatSuperpositionScorer { * TM score: Yang Zhang and Jeffrey Skolnick, PROTEINS: Structure, Function, and Bioinformatics 57:702–710 (2004) * @param subunits subunits to be scored * @param transformation transformation matrix - * @param permutations permutation that determines which subunits are superposed + * @param permutation permutation that determines which subunits are superposed * @return */ public static QuatSymmetryScores calcScores(QuatSymmetrySubunits subunits, Matrix4d transformation, List permutation) { diff --git a/biojava-structure/src/main/java/org/biojava/nbio/structure/symmetry/core/QuatSymmetrySubunits.java b/biojava-structure/src/main/java/org/biojava/nbio/structure/symmetry/core/QuatSymmetrySubunits.java index 98eb315855..b0bef7f1e6 100644 --- a/biojava-structure/src/main/java/org/biojava/nbio/structure/symmetry/core/QuatSymmetrySubunits.java +++ b/biojava-structure/src/main/java/org/biojava/nbio/structure/symmetry/core/QuatSymmetrySubunits.java @@ -76,6 +76,10 @@ public QuatSymmetrySubunits(List clusters) { clusterIds.add(c); Atom[] atoms = clusters.get(c).getAlignedAtomsSubunit(s); + if( atoms.length == 0) { + throw new IllegalArgumentException("No aligned atoms in subunit"); + } + Point3d[] points = Calc.atomsToPoints(atoms); caCoords.add(points); @@ -213,7 +217,7 @@ private void run() { calcOriginalCenters(); calcCentroid(); calcCenters(); - calcMomentsOfIntertia(); + calcMomentsOfInertia(); } private void calcOriginalCenters() { @@ -272,7 +276,7 @@ public Point3d getUpperBound() { return upper; } - private void calcMomentsOfIntertia() { + private void calcMomentsOfInertia() { for (Point3d[] trace : caCoords) { for (Point3d p : trace) { momentsOfInertia.addPoint(p, 1.0f); diff --git a/biojava-structure/src/main/java/org/biojava/nbio/structure/symmetry/core/Rotation.java b/biojava-structure/src/main/java/org/biojava/nbio/structure/symmetry/core/Rotation.java index 9f1410abc6..6a9b95c3a6 100644 --- a/biojava-structure/src/main/java/org/biojava/nbio/structure/symmetry/core/Rotation.java +++ b/biojava-structure/src/main/java/org/biojava/nbio/structure/symmetry/core/Rotation.java @@ -147,7 +147,7 @@ public int getDirection() { } /** - * @param direction the direction to set + * @param axis the direction to set */ public void setDirection(int axis) { this.direction = axis; diff --git a/biojava-structure/src/main/java/org/biojava/nbio/structure/symmetry/core/RotationGroup.java b/biojava-structure/src/main/java/org/biojava/nbio/structure/symmetry/core/RotationGroup.java index 9d25a7acbc..1490d27036 100644 --- a/biojava-structure/src/main/java/org/biojava/nbio/structure/symmetry/core/RotationGroup.java +++ b/biojava-structure/src/main/java/org/biojava/nbio/structure/symmetry/core/RotationGroup.java @@ -31,7 +31,7 @@ import java.util.List; /** - * @see http://en.wikipedia.org/wiki/Rotation_group_SO(3) + * See http://en.wikipedia.org/wiki/Rotation_group_SO(3) * @author Peter */ public class RotationGroup implements Iterable { @@ -98,7 +98,7 @@ public void complete() { public String getPointGroup() { if (modified) { - if (rotations.size() == 0) { + if (rotations.isEmpty()) { return "C1"; } complete(); diff --git a/biojava-structure/src/main/java/org/biojava/nbio/structure/symmetry/core/RotationSolver.java b/biojava-structure/src/main/java/org/biojava/nbio/structure/symmetry/core/RotationSolver.java index 37a44be7ac..b1566a6d2f 100644 --- a/biojava-structure/src/main/java/org/biojava/nbio/structure/symmetry/core/RotationSolver.java +++ b/biojava-structure/src/main/java/org/biojava/nbio/structure/symmetry/core/RotationSolver.java @@ -305,7 +305,7 @@ private boolean isSpherical() { * @return null if invalid, or a rotation if valid */ private Rotation isValidPermutation(List permutation) { - if (permutation.size() == 0) { + if (permutation.isEmpty()) { return null; } diff --git a/biojava-structure/src/main/java/org/biojava/nbio/structure/symmetry/core/Stoichiometry.java b/biojava-structure/src/main/java/org/biojava/nbio/structure/symmetry/core/Stoichiometry.java index dc6a09053f..697ee41f82 100644 --- a/biojava-structure/src/main/java/org/biojava/nbio/structure/symmetry/core/Stoichiometry.java +++ b/biojava-structure/src/main/java/org/biojava/nbio/structure/symmetry/core/Stoichiometry.java @@ -238,7 +238,7 @@ public int numberOfComponents() { } /** - * Make a combined Stoichiometry object of this and the other. + * Make a combined Stoichiometry object of this and the other. * The combined list of clusters will be ordered by the number of subunits. * @return new {@link Stoichiometry} object. */ diff --git a/biojava-structure/src/main/java/org/biojava/nbio/structure/symmetry/core/SystematicSolver.java b/biojava-structure/src/main/java/org/biojava/nbio/structure/symmetry/core/SystematicSolver.java index d13fa4db16..a449771b58 100644 --- a/biojava-structure/src/main/java/org/biojava/nbio/structure/symmetry/core/SystematicSolver.java +++ b/biojava-structure/src/main/java/org/biojava/nbio/structure/symmetry/core/SystematicSolver.java @@ -145,7 +145,7 @@ private void completeRotationGroup() { } private boolean isValidPermutation(List permutation) { - if (permutation.size() == 0) { + if (permutation.isEmpty()) { return false; } diff --git a/biojava-structure/src/main/java/org/biojava/nbio/structure/symmetry/geometry/DistanceBox.java b/biojava-structure/src/main/java/org/biojava/nbio/structure/symmetry/geometry/DistanceBox.java index 2d9b1d6dca..25d37693fb 100644 --- a/biojava-structure/src/main/java/org/biojava/nbio/structure/symmetry/geometry/DistanceBox.java +++ b/biojava-structure/src/main/java/org/biojava/nbio/structure/symmetry/geometry/DistanceBox.java @@ -166,7 +166,7 @@ private List getBoxTwo(long location) { } // ensure that boxTwo has no empty element by copying from tempBox of defined size List boxTwo = null; - if (tempBox.size() == 0) { + if (tempBox.isEmpty()) { boxTwo = Collections.emptyList(); } else if (tempBox.size() == 1) { boxTwo = Collections.singletonList(tempBox.get(0)); diff --git a/biojava-structure/src/main/java/org/biojava/nbio/structure/symmetry/geometry/Icosahedron.java b/biojava-structure/src/main/java/org/biojava/nbio/structure/symmetry/geometry/Icosahedron.java index 7de37ee842..5cb5a99458 100644 --- a/biojava-structure/src/main/java/org/biojava/nbio/structure/symmetry/geometry/Icosahedron.java +++ b/biojava-structure/src/main/java/org/biojava/nbio/structure/symmetry/geometry/Icosahedron.java @@ -67,7 +67,7 @@ public double getInscribedRadius() { /** * Sets the radius of an inscribed sphere, that is tangent to each * of the icosahedron's faces - * @param inscribedRadius the inscribedRadius to set + * @param radius the inscribedRadius to set */ public void setInscribedRadius(double radius) { double side = getSideLengthFromInscribedRadius(radius); @@ -88,7 +88,7 @@ public double getMidRadius() { /** * Sets the radius of radius of a sphere, that is tangent to each * of the icosahedron's edges - * @param midRadius the midRadius to set + * @param radius the midRadius to set */ public void setMidRadius(double radius) { double side = getSideLengthFromMiddleRadius(radius); diff --git a/biojava-structure/src/main/java/org/biojava/nbio/structure/symmetry/geometry/Octahedron.java b/biojava-structure/src/main/java/org/biojava/nbio/structure/symmetry/geometry/Octahedron.java index 6cc5842dda..3165093908 100644 --- a/biojava-structure/src/main/java/org/biojava/nbio/structure/symmetry/geometry/Octahedron.java +++ b/biojava-structure/src/main/java/org/biojava/nbio/structure/symmetry/geometry/Octahedron.java @@ -62,7 +62,7 @@ public double getInscribedRadius() { /** * Sets the radius of an inscribed sphere, that is tangent to each * of the octahedron's faces - * @param inscribedRadius the inscribedRadius to set + * @param radius the inscribedRadius to set */ public void setInscribedRadius(double radius) { double side = getSideLengthFromInscribedRadius(radius); @@ -83,7 +83,7 @@ public double getMidRadius() { /** * Sets the radius of radius of a sphere, that is tangent to each * of the octahedron's edges - * @param midRadius the midRadius to set + * @param radius the midRadius to set */ public void setMidRadius(double radius) { double side = getSideLengthFromMiddleRadius(radius); @@ -92,9 +92,6 @@ public void setMidRadius(double radius) { /** * Returns the vertices of an n-fold polygon of given radius and center - * @param n - * @param radius - * @param center * @return */ @Override diff --git a/biojava-structure/src/main/java/org/biojava/nbio/structure/symmetry/geometry/Prism.java b/biojava-structure/src/main/java/org/biojava/nbio/structure/symmetry/geometry/Prism.java index 770126b601..24166059fc 100644 --- a/biojava-structure/src/main/java/org/biojava/nbio/structure/symmetry/geometry/Prism.java +++ b/biojava-structure/src/main/java/org/biojava/nbio/structure/symmetry/geometry/Prism.java @@ -87,7 +87,7 @@ public double getInscribedRadius() { /** * Sets the radius of an inscribed sphere, that is tangent to each * of the icosahedron's faces - * @param inscribedRadius the inscribedRadius to set + * @param radius the inscribedRadius to set */ public void setInscribedRadius(double radius) { double side = getSideLengthFromInscribedRadius(radius, n); diff --git a/biojava-structure/src/main/java/org/biojava/nbio/structure/symmetry/geometry/RectangularPrism.java b/biojava-structure/src/main/java/org/biojava/nbio/structure/symmetry/geometry/RectangularPrism.java index 45d32828c3..295c6275e9 100644 --- a/biojava-structure/src/main/java/org/biojava/nbio/structure/symmetry/geometry/RectangularPrism.java +++ b/biojava-structure/src/main/java/org/biojava/nbio/structure/symmetry/geometry/RectangularPrism.java @@ -82,9 +82,6 @@ public double getCirumscribedRadius() { /** * Returns the vertices of an n-fold polygon of given radius and center - * @param n - * @param radius - * @param center * @return */ @Override diff --git a/biojava-structure/src/main/java/org/biojava/nbio/structure/symmetry/geometry/Tetrahedron.java b/biojava-structure/src/main/java/org/biojava/nbio/structure/symmetry/geometry/Tetrahedron.java index 7effd81cbe..a402cbef7e 100644 --- a/biojava-structure/src/main/java/org/biojava/nbio/structure/symmetry/geometry/Tetrahedron.java +++ b/biojava-structure/src/main/java/org/biojava/nbio/structure/symmetry/geometry/Tetrahedron.java @@ -66,7 +66,7 @@ public double getInscribedRadius() { /** * Sets the radius of an inscribed sphere, that is tangent to each * of the tetrahedron's faces - * @param inscribedRadius the inscribedRadius to set + * @param radius the inscribedRadius to set */ public void setInscribedRadius(double radius) { double side = getSideLengthFromInscribedRadius(radius); @@ -87,7 +87,7 @@ public double getMidRadius() { /** * Sets the radius of radius of a sphere, that is tangent to each * of the tetrahedron's edges - * @param midRadius the midRadius to set + * @param radius the midRadius to set */ public void setMidRadius(double radius) { double side = getSideLengthFromMiddleRadius(radius); @@ -96,9 +96,6 @@ public void setMidRadius(double radius) { /** * Returns the vertices of an n-fold polygon of given radius and center - * @param n - * @param radius - * @param center * @return */ @Override diff --git a/biojava-structure/src/main/java/org/biojava/nbio/structure/symmetry/internal/AngleOrderDetectorPlus.java b/biojava-structure/src/main/java/org/biojava/nbio/structure/symmetry/internal/AngleOrderDetectorPlus.java index 96b41f48e9..345493ce91 100644 --- a/biojava-structure/src/main/java/org/biojava/nbio/structure/symmetry/internal/AngleOrderDetectorPlus.java +++ b/biojava-structure/src/main/java/org/biojava/nbio/structure/symmetry/internal/AngleOrderDetectorPlus.java @@ -45,7 +45,7 @@ public class AngleOrderDetectorPlus implements OrderDetector { private boolean normalizeError; /** - * @param error + * @param angleError * maximum angular error, in radians */ public AngleOrderDetectorPlus(double angleError) { @@ -61,7 +61,7 @@ public AngleOrderDetectorPlus(int maxOrder) { * * @param maxOrder * maximum order to consider - * @param error + * @param angleError * maximum angular error, in radians */ public AngleOrderDetectorPlus(int maxOrder, double angleError) { @@ -82,7 +82,7 @@ public AngleOrderDetectorPlus(int maxOrder, double angleError) { * * @param maxOrder * maximum order to consider - * @param error + * @param angleError * maximum angular error * @param normalize * indicates whether error should be normalized by the order diff --git a/biojava-structure/src/main/java/org/biojava/nbio/structure/symmetry/internal/CeSymm.java b/biojava-structure/src/main/java/org/biojava/nbio/structure/symmetry/internal/CeSymm.java index 43ee89c234..b8ea01d6a1 100644 --- a/biojava-structure/src/main/java/org/biojava/nbio/structure/symmetry/internal/CeSymm.java +++ b/biojava-structure/src/main/java/org/biojava/nbio/structure/symmetry/internal/CeSymm.java @@ -82,7 +82,6 @@ public class CeSymm { *
    • 2.2 - run multiple symmetry levels recursively to find PG and * hierarchical symmetries. *
    - *
  • */ public static final String version = "2.2"; public static final String algorithmName = "jCE-symm"; @@ -364,7 +363,7 @@ public static CeSymmResult analyze(Atom[] atoms) throws StructureException { * * @param atoms * representative Atom array of the Structure - * @param param + * @param params * CeSymmParameters bean * @return CeSymmResult * @throws StructureException diff --git a/biojava-structure/src/main/java/org/biojava/nbio/structure/symmetry/internal/CeSymmIterative.java b/biojava-structure/src/main/java/org/biojava/nbio/structure/symmetry/internal/CeSymmIterative.java index 4527a7fa49..0700e34571 100644 --- a/biojava-structure/src/main/java/org/biojava/nbio/structure/symmetry/internal/CeSymmIterative.java +++ b/biojava-structure/src/main/java/org/biojava/nbio/structure/symmetry/internal/CeSymmIterative.java @@ -63,7 +63,6 @@ *
  • Repeat the last two steps until no more significant results are found. *
  • Map back all residues in a multiple alignment of the repeats. * - *
  • * * @author Aleix Lafita * @since 4.1.1 diff --git a/biojava-structure/src/main/java/org/biojava/nbio/structure/symmetry/internal/ResidueGroup.java b/biojava-structure/src/main/java/org/biojava/nbio/structure/symmetry/internal/ResidueGroup.java index a9e1bcdeb5..79053f55f9 100644 --- a/biojava-structure/src/main/java/org/biojava/nbio/structure/symmetry/internal/ResidueGroup.java +++ b/biojava-structure/src/main/java/org/biojava/nbio/structure/symmetry/internal/ResidueGroup.java @@ -76,7 +76,7 @@ public int order() { * ResidueGroups {A,B,C}, if A is compatible with B and B is compatible with * C, then A is not necessarily compatible with C. * - * @param c2 + * @param other * second maximally connected component * @return true if compatible, false otherwise */ diff --git a/biojava-structure/src/main/java/org/biojava/nbio/structure/symmetry/internal/SequenceFunctionRefiner.java b/biojava-structure/src/main/java/org/biojava/nbio/structure/symmetry/internal/SequenceFunctionRefiner.java index beeba62df2..a6ad226698 100644 --- a/biojava-structure/src/main/java/org/biojava/nbio/structure/symmetry/internal/SequenceFunctionRefiner.java +++ b/biojava-structure/src/main/java/org/biojava/nbio/structure/symmetry/internal/SequenceFunctionRefiner.java @@ -61,12 +61,12 @@ public MultipleAlignment refine(AFPChain selfAlignment, Atom[] atoms, /** * Refines a CE-Symm alignment so that it is perfectly symmetric. - * + *

    * The resulting alignment will have a one-to-one correspondance between * aligned residues of each symmetric part. * * @param afpChain Input alignment from CE-Symm - * @param k Symmetry order. This can be guessed by {@link CeSymm#getSymmetryOrder(AFPChain)} + * @param k Symmetry order. This can be guessed by {@link AlignmentTools#getSymmetryOrder(Map, Map, int, float)} * @return The refined alignment * @throws StructureException * @throws RefinerFailedException @@ -97,11 +97,11 @@ public static AFPChain refineSymmetry(AFPChain afpChain, Atom[] ca1, Atom[] ca2, /** * Refines a CE-Symm alignment so that it is perfectly symmetric. - * + *

    * The resulting alignment will have a one-to-one correspondance between * aligned residues of each symmetric part. * @param alignment The input alignment, as a map. This will be modified. - * @param k Symmetry order. This can be guessed by {@link CeSymm#getSymmetryOrder(AFPChain)} + * @param k Symmetry order. This can be guessed by {@link AlignmentTools#getSymmetryOrder(Map, Map, int, float)} * @return A modified map with the refined alignment * @throws StructureException */ diff --git a/biojava-structure/src/main/java/org/biojava/nbio/structure/symmetry/internal/SymmOptimizer.java b/biojava-structure/src/main/java/org/biojava/nbio/structure/symmetry/internal/SymmOptimizer.java index a974bf1659..d03e90080f 100644 --- a/biojava-structure/src/main/java/org/biojava/nbio/structure/symmetry/internal/SymmOptimizer.java +++ b/biojava-structure/src/main/java/org/biojava/nbio/structure/symmetry/internal/SymmOptimizer.java @@ -43,7 +43,7 @@ * Optimizes a symmetry alignment by a Monte Carlo score optimization of the * repeat multiple alignment. The superposition of the repeats is not free * (felxible), because it is constrained on the symmetry axes found in the - * structure. This is the main difference to the {@link MultipleMC} algorithm in + * structure. This is the main difference to the {@link org.biojava.nbio.structure.align.multiple.mc.MultipleMcMain} algorithm in * biojava. Another major difference is that the free Pool is shared for all * repeats, so that no residue can appear to more than one repeat at a time. *

    @@ -101,14 +101,12 @@ public class SymmOptimizer { private List mcScoreHistory; /** - * Constructor with a seed MultipleAligment storing a refined symmetry + * Constructor with a seed MultipleAlignment storing a refined symmetry * alignment of the repeats. To perform the optimization use the call or * optimize methods after instantiation. * * @param symmResult * CeSymmResult with all the information - * @throws RefinerFailedException - * @throws StructureException */ public SymmOptimizer(CeSymmResult symmResult) { @@ -181,11 +179,12 @@ private void initialize() throws StructureException, RefinerFailedException { * Optimization method based in a Monte-Carlo approach. Starting from the * refined alignment uses 4 types of moves: *

    + *

      *
    • 1- Shift Row: if there are enough freePool residues available. *
    • 2- Expand Block: add another alignment column. *
    • 3- Shrink Block: move a block column to the freePool. *
    • 4- Insert gap: insert a gap in a position of the alignment. - * + *
    * @throws StructureException * @throws RefinerFailedException * if the alignment is not symmetric or too short. diff --git a/biojava-structure/src/main/java/org/biojava/nbio/structure/symmetry/utils/SymmetryTools.java b/biojava-structure/src/main/java/org/biojava/nbio/structure/symmetry/utils/SymmetryTools.java index 431babdd5f..76822af35f 100644 --- a/biojava-structure/src/main/java/org/biojava/nbio/structure/symmetry/utils/SymmetryTools.java +++ b/biojava-structure/src/main/java/org/biojava/nbio/structure/symmetry/utils/SymmetryTools.java @@ -53,8 +53,10 @@ import org.biojava.nbio.structure.align.multiple.MultipleAlignmentImpl; import org.biojava.nbio.structure.align.multiple.util.CoreSuperimposer; import org.biojava.nbio.structure.align.multiple.util.MultipleAlignmentScorer; +import org.biojava.nbio.structure.align.multiple.util.MultipleAlignmentTools; import org.biojava.nbio.structure.align.multiple.util.MultipleSuperimposer; import org.biojava.nbio.structure.cluster.Subunit; +import org.biojava.nbio.structure.cluster.SubunitCluster; import org.biojava.nbio.structure.cluster.SubunitClustererMethod; import org.biojava.nbio.structure.cluster.SubunitClustererParameters; import org.biojava.nbio.structure.geometry.SuperPositions; @@ -62,6 +64,7 @@ import org.biojava.nbio.structure.symmetry.core.QuatSymmetryDetector; import org.biojava.nbio.structure.symmetry.core.QuatSymmetryParameters; import org.biojava.nbio.structure.symmetry.core.QuatSymmetryResults; +import org.biojava.nbio.structure.symmetry.core.Stoichiometry; import org.biojava.nbio.structure.symmetry.internal.CeSymmResult; import org.biojava.nbio.structure.symmetry.internal.SymmetryAxes; import org.jgrapht.Graph; @@ -498,7 +501,7 @@ public static Graph buildSymmetryGraph( * @param symmetry * CeSymmResult * @throws StructureException - * @result List of structures, by repeat index sequentially + * @return List of structures, by repeat index sequentially * */ public static List divideStructure(CeSymmResult symmetry) @@ -706,21 +709,18 @@ public static QuatSymmetryResults getQuaternarySymmetry(CeSymmResult result) throws StructureException { // Obtain the subunits of the repeats - List atoms = toRepeatsAlignment(result).getAtomArrays(); + MultipleAlignment msa = toRepeatsAlignment(result); + List atoms = msa.getAtomArrays(); List subunits = atoms.stream() .map(a -> new Subunit(a, null, null, null)) .collect(Collectors.toList()); - - // The clustering thresholds are set to 0 so that all always merged - SubunitClustererParameters cp = new SubunitClustererParameters(); - cp.setClustererMethod(SubunitClustererMethod.STRUCTURE); - cp.setRMSDThreshold(10.0); - cp.setStructureCoverageThreshold(0.0); + List> eqr = MultipleAlignmentTools.getEquivalentResidues(msa, true); + SubunitCluster cluster = new SubunitCluster(subunits, eqr); + Stoichiometry composition = new Stoichiometry(Arrays.asList(cluster)); QuatSymmetryParameters sp = new QuatSymmetryParameters(); - QuatSymmetryResults gSymmetry = QuatSymmetryDetector - .calcGlobalSymmetry(subunits, sp, cp); + .calcGlobalSymmetry(composition, sp); return gSymmetry; } diff --git a/biojava-structure/src/main/java/org/biojava/nbio/structure/xtal/SpaceGroup.java b/biojava-structure/src/main/java/org/biojava/nbio/structure/xtal/SpaceGroup.java index cff84c70f8..852d213bb9 100644 --- a/biojava-structure/src/main/java/org/biojava/nbio/structure/xtal/SpaceGroup.java +++ b/biojava-structure/src/main/java/org/biojava/nbio/structure/xtal/SpaceGroup.java @@ -645,10 +645,10 @@ public List getTransfAlgebraic() { public void setTransfAlgebraic(List transfAlgebraic) { //System.out.println("setting transfAlgebraic " + transfAlgebraic); - if ( transformations == null || transformations.size() == 0) + if ( transformations == null || transformations.isEmpty()) transformations = new ArrayList(transfAlgebraic.size()); - if ( this.transfAlgebraic == null || this.transfAlgebraic.size() == 0) + if ( this.transfAlgebraic == null || this.transfAlgebraic.isEmpty()) this.transfAlgebraic = new ArrayList<>(transfAlgebraic.size()); for ( String transf : transfAlgebraic){ diff --git a/biojava-structure/src/main/java/org/biojava/nbio/structure/xtal/SymoplibParser.java b/biojava-structure/src/main/java/org/biojava/nbio/structure/xtal/SymoplibParser.java index 5d58e019eb..0de5e33bc4 100644 --- a/biojava-structure/src/main/java/org/biojava/nbio/structure/xtal/SymoplibParser.java +++ b/biojava-structure/src/main/java/org/biojava/nbio/structure/xtal/SymoplibParser.java @@ -185,8 +185,8 @@ public static TreeMap getAllSpaceGroups() { * A parser for the symop.lib file provided by CCP4. Note: this file is not getting re-distributed by BioJava. * It can be downloaded from: * - * http://www.ccp4.ac.uk/cvs/viewvc.cgi/libccp4/data/symop.lib?revision=1.10&view=markup - * + * http://www.ccp4.ac.uk/cvs/viewvc.cgi/libccp4/data/symop.lib?revision=1.10&view=markup + *

    * Note: this file is not needed by BioJava. BioJava loads equivalent information from the file spacegroups.xml * * @param symoplibIS diff --git a/biojava-structure/src/test/java/org/biojava/nbio/structure/HetatomImplTest.java b/biojava-structure/src/test/java/org/biojava/nbio/structure/HetatomImplTest.java index 74556c2434..8f9d190a71 100644 --- a/biojava-structure/src/test/java/org/biojava/nbio/structure/HetatomImplTest.java +++ b/biojava-structure/src/test/java/org/biojava/nbio/structure/HetatomImplTest.java @@ -29,7 +29,7 @@ /** * - * @author Jules Jacobsen + * @author Jules Jacobsen jacobsen@ebi.ac.uk */ public class HetatomImplTest { diff --git a/biojava-structure/src/test/java/org/biojava/nbio/structure/PDBStatusTest.java b/biojava-structure/src/test/java/org/biojava/nbio/structure/PDBStatusTest.java index 82e26bd802..6d97b0889d 100644 --- a/biojava-structure/src/test/java/org/biojava/nbio/structure/PDBStatusTest.java +++ b/biojava-structure/src/test/java/org/biojava/nbio/structure/PDBStatusTest.java @@ -27,7 +27,7 @@ import java.io.IOException; /** - * @author Spencer Bliven + * @author Spencer Bliven sbliven@ucsd.edu * */ public class PDBStatusTest { diff --git a/biojava-structure/src/test/java/org/biojava/nbio/structure/ResidueNumberTest.java b/biojava-structure/src/test/java/org/biojava/nbio/structure/ResidueNumberTest.java index c594f0dd18..c5ebb6c028 100644 --- a/biojava-structure/src/test/java/org/biojava/nbio/structure/ResidueNumberTest.java +++ b/biojava-structure/src/test/java/org/biojava/nbio/structure/ResidueNumberTest.java @@ -29,7 +29,7 @@ /** * - * @author Jules Jacobsen + * @author Jules Jacobsen jacobsen@ebi.ac.uk */ public class ResidueNumberTest { diff --git a/biojava-structure/src/test/java/org/biojava/nbio/structure/SiteTest.java b/biojava-structure/src/test/java/org/biojava/nbio/structure/SiteTest.java index d7a64d0017..5e39000e90 100644 --- a/biojava-structure/src/test/java/org/biojava/nbio/structure/SiteTest.java +++ b/biojava-structure/src/test/java/org/biojava/nbio/structure/SiteTest.java @@ -29,7 +29,7 @@ /** * Tests functionality of Site class. - * @author Jules Jacobsen + * @author Jules Jacobsen jacobsen@ebi.ac.uk */ public class SiteTest { diff --git a/biojava-structure/src/test/java/org/biojava/nbio/structure/align/util/AtomCacheTest.java b/biojava-structure/src/test/java/org/biojava/nbio/structure/align/util/AtomCacheTest.java index ec2763df9a..073a679dbb 100644 --- a/biojava-structure/src/test/java/org/biojava/nbio/structure/align/util/AtomCacheTest.java +++ b/biojava-structure/src/test/java/org/biojava/nbio/structure/align/util/AtomCacheTest.java @@ -165,7 +165,7 @@ public void testGetStructureForDomain3() throws IOException, StructureException } /** - * Test parsing of chain-less ranges (present in SCOP < 1.73) + * Test parsing of chain-less ranges (present in SCOP < 1.73) * @throws IOException * @throws StructureException */ diff --git a/biojava-structure/src/test/java/org/biojava/nbio/structure/io/mmtf/TestMmtfRoundTrip.java b/biojava-structure/src/test/java/org/biojava/nbio/structure/io/mmtf/TestMmtfRoundTrip.java index e362c2a35f..5190bd38c1 100644 --- a/biojava-structure/src/test/java/org/biojava/nbio/structure/io/mmtf/TestMmtfRoundTrip.java +++ b/biojava-structure/src/test/java/org/biojava/nbio/structure/io/mmtf/TestMmtfRoundTrip.java @@ -354,8 +354,8 @@ private void checkBioAssemblies1(Structure structOne, Structure structTwo) throw @Test public void testStructWithBranchedEntitiesRoundTrip() throws IOException { - // Example carbohydrate remediation file to be released in July 2020 - URL url = new URL("https://raw.githubusercontent.com/pdbxmmcifwg/carbohydrate-extension/master/examples/models/1B5F-carb.cif"); + // Example carbohydrate remediation, remediated in July 2020 + URL url = new URL("https://files.rcsb.org/download/1B5F.cif.gz"); InputStream inStream = url.openStream(); Structure structure = CifStructureConverter.fromInputStream(inStream); @@ -366,7 +366,7 @@ public void testStructWithBranchedEntitiesRoundTrip() throws IOException { new StructureDataToAdapter(writerToEncoder, mmtfStructureReader); Structure structure2 = mmtfStructureReader.getStructure(); - assertEquals(7, structure2.getEntityInfos().size()); + assertEquals(6, structure2.getEntityInfos().size()); assertEquals(2, structure2.getEntityById(1).getChains().size()); assertEquals(2, structure2.getEntityById(2).getChains().size()); diff --git a/biojava-structure/src/test/java/org/biojava/nbio/structure/symmetry/internal/TestCeSymm.java b/biojava-structure/src/test/java/org/biojava/nbio/structure/symmetry/internal/TestCeSymm.java index a21019711b..9d3b67e3ef 100644 --- a/biojava-structure/src/test/java/org/biojava/nbio/structure/symmetry/internal/TestCeSymm.java +++ b/biojava-structure/src/test/java/org/biojava/nbio/structure/symmetry/internal/TestCeSymm.java @@ -22,6 +22,7 @@ import static org.junit.Assert.*; import static org.junit.Assume.assumeNotNull; +import static org.junit.jupiter.api.Assertions.assertNotNull; import java.io.IOException; import java.io.InputStream; @@ -60,7 +61,7 @@ public void testEasyCases() throws IOException, StructureException { CeSymmResult result = CeSymm.analyze(atoms); assertTrue(result.isSignificant()); - assertEquals(result.getNumRepeats(), orders[i]); + assertEquals(orders[i], result.getNumRepeats()); } } @@ -75,4 +76,26 @@ public void testAlphafold() throws IOException, StructureException { CeSymmResult result = CeSymm.analyze(atoms); assertNotNull(result); } + + @Test + public void testShort() throws IOException, StructureException { + // ERIC2_c35200, a near-perfect 15 residue beta-solenoid + // At 15 residues this should reliably trigger rcsb/symmetry#118 + URL url = this.getClass().getResource("/AF-V9WDR2-F1-model_v4.cif"); + assumeNotNull(url); + String file = url.getPath(); + Structure s = StructureIO.getStructure(file); + assertNull(s.getPdbId()); + Atom[] atoms = StructureTools.getRepresentativeAtomArray(s); + CESymmParameters params = new CESymmParameters(); + params.setMinCoreLength(10); // Ensure it gets refined (should be 15 long) + CeSymmResult result = CeSymm.analyze(atoms, params); + assertNotNull(result); + assertTrue(result.isSignificant()); + assertEquals(9, result.getNumRepeats()); + assertEquals("H",result.getSymmGroup()); + assertNotNull(result.getAxes()); + assertNotEquals("Error", result.getReason()); + + } } diff --git a/biojava-structure/src/test/resources/AF-V9WDR2-F1-model_v4.cif b/biojava-structure/src/test/resources/AF-V9WDR2-F1-model_v4.cif new file mode 100644 index 0000000000..c959135a6e --- /dev/null +++ b/biojava-structure/src/test/resources/AF-V9WDR2-F1-model_v4.cif @@ -0,0 +1,2012 @@ +data_AF-V9WDR2-F1 +# +_entry.id AF-V9WDR2-F1 +# +loop_ +_atom_type.symbol +C +N +O +S +# +loop_ +_audit_author.name +_audit_author.pdbx_ordinal +"Jumper, John" 1 +"Evans, Richard" 2 +"Pritzel, Alexander" 3 +"Green, Tim" 4 +"Figurnov, Michael" 5 +"Ronneberger, Olaf" 6 +"Tunyasuvunakool, Kathryn" 7 +"Bates, Russ" 8 +"Zidek, Augustin" 9 +"Potapenko, Anna" 10 +"Bridgland, Alex" 11 +"Meyer, Clemens" 12 +"Kohl, Simon A. A." 13 +"Ballard, Andrew J." 14 +"Cowie, Andrew" 15 +"Romera-Paredes, Bernardino" 16 +"Nikolov, Stanislav" 17 +"Jain, Rishub" 18 +"Adler, Jonas" 19 +"Back, Trevor" 20 +"Petersen, Stig" 21 +"Reiman, David" 22 +"Clancy, Ellen" 23 +"Zielinski, Michal" 24 +"Steinegger, Martin" 25 +"Pacholska, Michalina" 26 +"Berghammer, Tamas" 27 +"Silver, David" 28 +"Vinyals, Oriol" 29 +"Senior, Andrew W." 30 +"Kavukcuoglu, Koray" 31 +"Kohli, Pushmeet" 32 +"Hassabis, Demis" 33 +# +_audit_conform.dict_location https://raw.githubusercontent.com/ihmwg/ModelCIF/master/dist/mmcif_ma.dic +_audit_conform.dict_name mmcif_ma.dic +_audit_conform.dict_version 1.3.9 +# +loop_ +_chem_comp.formula +_chem_comp.formula_weight +_chem_comp.id +_chem_comp.mon_nstd_flag +_chem_comp.name +_chem_comp.pdbx_synonyms +_chem_comp.type +"C3 H7 N O2" 89.093 ALA y ALANINE ? "L-PEPTIDE LINKING" +"C6 H15 N4 O2" 175.209 ARG y ARGININE ? "L-PEPTIDE LINKING" +"C4 H8 N2 O3" 132.118 ASN y ASPARAGINE ? "L-PEPTIDE LINKING" +"C4 H7 N O4" 133.103 ASP y "ASPARTIC ACID" ? "L-PEPTIDE LINKING" +"C3 H7 N O2 S" 121.158 CYS y CYSTEINE ? "L-PEPTIDE LINKING" +"C5 H10 N2 O3" 146.144 GLN y GLUTAMINE ? "L-PEPTIDE LINKING" +"C5 H9 N O4" 147.129 GLU y "GLUTAMIC ACID" ? "L-PEPTIDE LINKING" +"C2 H5 N O2" 75.067 GLY y GLYCINE ? "PEPTIDE LINKING" +"C6 H10 N3 O2" 156.162 HIS y HISTIDINE ? "L-PEPTIDE LINKING" +"C6 H13 N O2" 131.173 ILE y ISOLEUCINE ? "L-PEPTIDE LINKING" +"C6 H15 N2 O2" 147.195 LYS y LYSINE ? "L-PEPTIDE LINKING" +"C5 H11 N O2 S" 149.211 MET y METHIONINE ? "L-PEPTIDE LINKING" +"C9 H11 N O2" 165.189 PHE y PHENYLALANINE ? "L-PEPTIDE LINKING" +"C3 H7 N O3" 105.093 SER y SERINE ? "L-PEPTIDE LINKING" +"C4 H9 N O3" 119.119 THR y THREONINE ? "L-PEPTIDE LINKING" +"C5 H11 N O2" 117.146 VAL y VALINE ? "L-PEPTIDE LINKING" +# +_citation.book_publisher ? +_citation.country UK +_citation.id primary +_citation.journal_full Nature +_citation.journal_id_ASTM NATUAS +_citation.journal_id_CSD 0006 +_citation.journal_id_ISSN 0028-0836 +_citation.journal_volume 596 +_citation.page_first 583 +_citation.page_last 589 +_citation.pdbx_database_id_DOI 10.1038/s41586-021-03819-2 +_citation.pdbx_database_id_PubMed 34265844 +_citation.title "Highly accurate protein structure prediction with AlphaFold" +_citation.year 2021 +# +loop_ +_citation_author.citation_id +_citation_author.name +_citation_author.ordinal +1 "Jumper, John" 1 +1 "Evans, Richard" 2 +1 "Pritzel, Alexander" 3 +1 "Green, Tim" 4 +1 "Figurnov, Michael" 5 +1 "Ronneberger, Olaf" 6 +1 "Tunyasuvunakool, Kathryn" 7 +1 "Bates, Russ" 8 +1 "Zidek, Augustin" 9 +1 "Potapenko, Anna" 10 +1 "Bridgland, Alex" 11 +1 "Meyer, Clemens" 12 +1 "Kohl, Simon A. A." 13 +1 "Ballard, Andrew J." 14 +1 "Cowie, Andrew" 15 +1 "Romera-Paredes, Bernardino" 16 +1 "Nikolov, Stanislav" 17 +1 "Jain, Rishub" 18 +1 "Adler, Jonas" 19 +1 "Back, Trevor" 20 +1 "Petersen, Stig" 21 +1 "Reiman, David" 22 +1 "Clancy, Ellen" 23 +1 "Zielinski, Michal" 24 +1 "Steinegger, Martin" 25 +1 "Pacholska, Michalina" 26 +1 "Berghammer, Tamas" 27 +1 "Silver, David" 28 +1 "Vinyals, Oriol" 29 +1 "Senior, Andrew W." 30 +1 "Kavukcuoglu, Koray" 31 +1 "Kohli, Pushmeet" 32 +1 "Hassabis, Demis" 33 +# +_database_2.database_code AF-V9WDR2-F1 +_database_2.database_id AlphaFoldDB +# +_entity.details ? +_entity.formula_weight ? +_entity.id 1 +_entity.pdbx_description "Uncharacterized protein" +_entity.pdbx_ec ? +_entity.pdbx_fragment ? +_entity.pdbx_mutation ? +_entity.pdbx_number_of_molecules 1 +_entity.src_method man +_entity.type polymer +# +_entity_poly.entity_id 1 +_entity_poly.nstd_linkage no +_entity_poly.nstd_monomer no +_entity_poly.pdbx_seq_one_letter_code +;MIMKNKNKQNRKAFADTEFASEAGANRTAADTEFASEAGANRTVADTEFASEAGANTTAADTEFASEAGANRTAADTEFA +SEAGANRTAADTEFASEAGANTTAADTEFASEAGANRTAADTEFASEVRANRTSADTEFANEVTSKQNRCGH +; +_entity_poly.pdbx_seq_one_letter_code_can +;MIMKNKNKQNRKAFADTEFASEAGANRTAADTEFASEAGANRTVADTEFASEAGANTTAADTEFASEAGANRTAADTEFA +SEAGANRTAADTEFASEAGANTTAADTEFASEAGANRTAADTEFASEVRANRTSADTEFANEVTSKQNRCGH +; +_entity_poly.pdbx_strand_id A +_entity_poly.type polypeptide(L) +# +loop_ +_entity_poly_seq.entity_id +_entity_poly_seq.hetero +_entity_poly_seq.mon_id +_entity_poly_seq.num +1 n MET 1 +1 n ILE 2 +1 n MET 3 +1 n LYS 4 +1 n ASN 5 +1 n LYS 6 +1 n ASN 7 +1 n LYS 8 +1 n GLN 9 +1 n ASN 10 +1 n ARG 11 +1 n LYS 12 +1 n ALA 13 +1 n PHE 14 +1 n ALA 15 +1 n ASP 16 +1 n THR 17 +1 n GLU 18 +1 n PHE 19 +1 n ALA 20 +1 n SER 21 +1 n GLU 22 +1 n ALA 23 +1 n GLY 24 +1 n ALA 25 +1 n ASN 26 +1 n ARG 27 +1 n THR 28 +1 n ALA 29 +1 n ALA 30 +1 n ASP 31 +1 n THR 32 +1 n GLU 33 +1 n PHE 34 +1 n ALA 35 +1 n SER 36 +1 n GLU 37 +1 n ALA 38 +1 n GLY 39 +1 n ALA 40 +1 n ASN 41 +1 n ARG 42 +1 n THR 43 +1 n VAL 44 +1 n ALA 45 +1 n ASP 46 +1 n THR 47 +1 n GLU 48 +1 n PHE 49 +1 n ALA 50 +1 n SER 51 +1 n GLU 52 +1 n ALA 53 +1 n GLY 54 +1 n ALA 55 +1 n ASN 56 +1 n THR 57 +1 n THR 58 +1 n ALA 59 +1 n ALA 60 +1 n ASP 61 +1 n THR 62 +1 n GLU 63 +1 n PHE 64 +1 n ALA 65 +1 n SER 66 +1 n GLU 67 +1 n ALA 68 +1 n GLY 69 +1 n ALA 70 +1 n ASN 71 +1 n ARG 72 +1 n THR 73 +1 n ALA 74 +1 n ALA 75 +1 n ASP 76 +1 n THR 77 +1 n GLU 78 +1 n PHE 79 +1 n ALA 80 +1 n SER 81 +1 n GLU 82 +1 n ALA 83 +1 n GLY 84 +1 n ALA 85 +1 n ASN 86 +1 n ARG 87 +1 n THR 88 +1 n ALA 89 +1 n ALA 90 +1 n ASP 91 +1 n THR 92 +1 n GLU 93 +1 n PHE 94 +1 n ALA 95 +1 n SER 96 +1 n GLU 97 +1 n ALA 98 +1 n GLY 99 +1 n ALA 100 +1 n ASN 101 +1 n THR 102 +1 n THR 103 +1 n ALA 104 +1 n ALA 105 +1 n ASP 106 +1 n THR 107 +1 n GLU 108 +1 n PHE 109 +1 n ALA 110 +1 n SER 111 +1 n GLU 112 +1 n ALA 113 +1 n GLY 114 +1 n ALA 115 +1 n ASN 116 +1 n ARG 117 +1 n THR 118 +1 n ALA 119 +1 n ALA 120 +1 n ASP 121 +1 n THR 122 +1 n GLU 123 +1 n PHE 124 +1 n ALA 125 +1 n SER 126 +1 n GLU 127 +1 n VAL 128 +1 n ARG 129 +1 n ALA 130 +1 n ASN 131 +1 n ARG 132 +1 n THR 133 +1 n SER 134 +1 n ALA 135 +1 n ASP 136 +1 n THR 137 +1 n GLU 138 +1 n PHE 139 +1 n ALA 140 +1 n ASN 141 +1 n GLU 142 +1 n VAL 143 +1 n THR 144 +1 n SER 145 +1 n LYS 146 +1 n GLN 147 +1 n ASN 148 +1 n ARG 149 +1 n CYS 150 +1 n GLY 151 +1 n HIS 152 +# +loop_ +_ma_data.content_type +_ma_data.id +_ma_data.name +"model coordinates" 1 Model +"input structure" 2 "Input structure" +# +_ma_model_list.data_id 1 +_ma_model_list.model_group_id 1 +_ma_model_list.model_group_name "AlphaFold Monomer v2.0 model" +_ma_model_list.model_id 1 +_ma_model_list.model_name "Top ranked model" +_ma_model_list.model_type "Ab initio model" +_ma_model_list.ordinal_id 1 +# +loop_ +_ma_protocol_step.method_type +_ma_protocol_step.ordinal_id +_ma_protocol_step.protocol_id +_ma_protocol_step.step_id +"coevolution MSA" 1 1 1 +"template search" 2 1 2 +modeling 3 1 3 +# +loop_ +_ma_qa_metric.id +_ma_qa_metric.mode +_ma_qa_metric.name +_ma_qa_metric.software_group_id +_ma_qa_metric.type +1 global pLDDT 1 pLDDT +2 local pLDDT 1 pLDDT +# +_ma_qa_metric_global.metric_id 1 +_ma_qa_metric_global.metric_value 90.14 +_ma_qa_metric_global.model_id 1 +_ma_qa_metric_global.ordinal_id 1 +# +loop_ +_ma_qa_metric_local.label_asym_id +_ma_qa_metric_local.label_comp_id +_ma_qa_metric_local.label_seq_id +_ma_qa_metric_local.metric_id +_ma_qa_metric_local.metric_value +_ma_qa_metric_local.model_id +_ma_qa_metric_local.ordinal_id +A MET 1 2 34.44 1 1 +A ILE 2 2 38.03 1 2 +A MET 3 2 39.03 1 3 +A LYS 4 2 45.03 1 4 +A ASN 5 2 42.38 1 5 +A LYS 6 2 47.50 1 6 +A ASN 7 2 44.88 1 7 +A LYS 8 2 44.59 1 8 +A GLN 9 2 48.12 1 9 +A ASN 10 2 55.12 1 10 +A ARG 11 2 56.03 1 11 +A LYS 12 2 73.56 1 12 +A ALA 13 2 77.81 1 13 +A PHE 14 2 80.12 1 14 +A ALA 15 2 80.38 1 15 +A ASP 16 2 87.81 1 16 +A THR 17 2 90.19 1 17 +A GLU 18 2 91.25 1 18 +A PHE 19 2 90.44 1 19 +A ALA 20 2 88.88 1 20 +A SER 21 2 92.38 1 21 +A GLU 22 2 87.19 1 22 +A ALA 23 2 90.38 1 23 +A GLY 24 2 86.38 1 24 +A ALA 25 2 84.62 1 25 +A ASN 26 2 89.00 1 26 +A ARG 27 2 88.31 1 27 +A THR 28 2 91.44 1 28 +A ALA 29 2 90.12 1 29 +A ALA 30 2 90.31 1 30 +A ASP 31 2 92.75 1 31 +A THR 32 2 95.44 1 32 +A GLU 33 2 95.38 1 33 +A PHE 34 2 95.44 1 34 +A ALA 35 2 94.94 1 35 +A SER 36 2 96.62 1 36 +A GLU 37 2 94.25 1 37 +A ALA 38 2 95.38 1 38 +A GLY 39 2 92.50 1 39 +A ALA 40 2 92.38 1 40 +A ASN 41 2 93.56 1 41 +A ARG 42 2 93.56 1 42 +A THR 43 2 95.69 1 43 +A VAL 44 2 94.94 1 44 +A ALA 45 2 95.31 1 45 +A ASP 46 2 96.00 1 46 +A THR 47 2 97.12 1 47 +A GLU 48 2 97.81 1 48 +A PHE 49 2 97.81 1 49 +A ALA 50 2 97.12 1 50 +A SER 51 2 98.19 1 51 +A GLU 52 2 97.38 1 52 +A ALA 53 2 97.81 1 53 +A GLY 54 2 96.44 1 54 +A ALA 55 2 96.31 1 55 +A ASN 56 2 97.44 1 56 +A THR 57 2 96.94 1 57 +A THR 58 2 98.06 1 58 +A ALA 59 2 96.69 1 59 +A ALA 60 2 97.00 1 60 +A ASP 61 2 97.75 1 61 +A THR 62 2 97.94 1 62 +A GLU 63 2 98.44 1 63 +A PHE 64 2 98.50 1 64 +A ALA 65 2 97.81 1 65 +A SER 66 2 98.56 1 66 +A GLU 67 2 98.00 1 67 +A ALA 68 2 98.38 1 68 +A GLY 69 2 97.75 1 69 +A ALA 70 2 97.75 1 70 +A ASN 71 2 98.25 1 71 +A ARG 72 2 97.94 1 72 +A THR 73 2 98.50 1 73 +A ALA 74 2 96.81 1 74 +A ALA 75 2 97.69 1 75 +A ASP 76 2 98.12 1 76 +A THR 77 2 98.19 1 77 +A GLU 78 2 98.62 1 78 +A PHE 79 2 98.56 1 79 +A ALA 80 2 97.94 1 80 +A SER 81 2 98.62 1 81 +A GLU 82 2 98.19 1 82 +A ALA 83 2 98.50 1 83 +A GLY 84 2 98.00 1 84 +A ALA 85 2 98.06 1 85 +A ASN 86 2 98.44 1 86 +A ARG 87 2 98.12 1 87 +A THR 88 2 98.50 1 88 +A ALA 89 2 97.12 1 89 +A ALA 90 2 97.75 1 90 +A ASP 91 2 98.25 1 91 +A THR 92 2 98.06 1 92 +A GLU 93 2 98.56 1 93 +A PHE 94 2 98.56 1 94 +A ALA 95 2 97.81 1 95 +A SER 96 2 98.56 1 96 +A GLU 97 2 98.25 1 97 +A ALA 98 2 98.44 1 98 +A GLY 99 2 97.88 1 99 +A ALA 100 2 98.12 1 100 +A ASN 101 2 98.44 1 101 +A THR 102 2 97.62 1 102 +A THR 103 2 98.12 1 103 +A ALA 104 2 96.81 1 104 +A ALA 105 2 97.00 1 105 +A ASP 106 2 97.88 1 106 +A THR 107 2 97.62 1 107 +A GLU 108 2 98.44 1 108 +A PHE 109 2 98.31 1 109 +A ALA 110 2 97.31 1 110 +A SER 111 2 98.31 1 111 +A GLU 112 2 97.62 1 112 +A ALA 113 2 98.06 1 113 +A GLY 114 2 97.62 1 114 +A ALA 115 2 97.62 1 115 +A ASN 116 2 97.75 1 116 +A ARG 117 2 96.31 1 117 +A THR 118 2 97.12 1 118 +A ALA 119 2 94.94 1 119 +A ALA 120 2 95.56 1 120 +A ASP 121 2 96.00 1 121 +A THR 122 2 95.94 1 122 +A GLU 123 2 97.62 1 123 +A PHE 124 2 97.56 1 124 +A ALA 125 2 96.31 1 125 +A SER 126 2 97.81 1 126 +A GLU 127 2 96.75 1 127 +A VAL 128 2 97.75 1 128 +A ARG 129 2 97.06 1 129 +A ALA 130 2 96.44 1 130 +A ASN 131 2 96.19 1 131 +A ARG 132 2 94.06 1 132 +A THR 133 2 95.19 1 133 +A SER 134 2 91.88 1 134 +A ALA 135 2 93.06 1 135 +A ASP 136 2 92.88 1 136 +A THR 137 2 93.31 1 137 +A GLU 138 2 95.25 1 138 +A PHE 139 2 95.06 1 139 +A ALA 140 2 94.06 1 140 +A ASN 141 2 95.62 1 141 +A GLU 142 2 93.50 1 142 +A VAL 143 2 94.88 1 143 +A THR 144 2 93.44 1 144 +A SER 145 2 93.50 1 145 +A LYS 146 2 91.69 1 146 +A GLN 147 2 89.00 1 147 +A ASN 148 2 91.25 1 148 +A ARG 149 2 85.00 1 149 +A CYS 150 2 71.25 1 150 +A GLY 151 2 59.62 1 151 +A HIS 152 2 47.81 1 152 +# +_ma_software_group.group_id 1 +_ma_software_group.ordinal_id 1 +_ma_software_group.software_id 1 +# +_ma_target_entity.data_id 1 +_ma_target_entity.entity_id 1 +_ma_target_entity.origin "reference database" +# +_ma_target_entity_instance.asym_id A +_ma_target_entity_instance.details . +_ma_target_entity_instance.entity_id 1 +# +_ma_target_ref_db_details.db_accession V9WDR2 +_ma_target_ref_db_details.db_code V9WDR2_9BACL +_ma_target_ref_db_details.db_name UNP +_ma_target_ref_db_details.gene_name ERIC2_c35200 +_ma_target_ref_db_details.ncbi_taxonomy_id 697284 +_ma_target_ref_db_details.organism_scientific "Paenibacillus larvae subsp. larvae DSM 25430" +_ma_target_ref_db_details.seq_db_align_begin 1 +_ma_target_ref_db_details.seq_db_align_end 152 +_ma_target_ref_db_details.seq_db_isoform ? +_ma_target_ref_db_details.seq_db_sequence_checksum 35E70E5C15D19AFF +_ma_target_ref_db_details.seq_db_sequence_version_date 2014-03-19 +_ma_target_ref_db_details.target_entity_id 1 +# +loop_ +_ma_template_details.ordinal_id +_ma_template_details.target_asym_id +_ma_template_details.template_auth_asym_id +_ma_template_details.template_data_id +_ma_template_details.template_entity_type +_ma_template_details.template_id +_ma_template_details.template_model_num +_ma_template_details.template_origin +_ma_template_details.template_trans_matrix_id +1 A J 2 polymer 1 1 "reference database" 1 +2 A A 2 polymer 2 1 "reference database" 1 +# +loop_ +_ma_template_ref_db_details.db_accession_code +_ma_template_ref_db_details.db_name +_ma_template_ref_db_details.template_id +6J9E PDB 1 +2MC6 PDB 2 +# +_ma_template_trans_matrix.id 1 +_ma_template_trans_matrix.rot_matrix[1][1] 1.0 +_ma_template_trans_matrix.rot_matrix[1][2] 0.0 +_ma_template_trans_matrix.rot_matrix[1][3] 0.0 +_ma_template_trans_matrix.rot_matrix[2][1] 0.0 +_ma_template_trans_matrix.rot_matrix[2][2] 1.0 +_ma_template_trans_matrix.rot_matrix[2][3] 0.0 +_ma_template_trans_matrix.rot_matrix[3][1] 0.0 +_ma_template_trans_matrix.rot_matrix[3][2] 0.0 +_ma_template_trans_matrix.rot_matrix[3][3] 1.0 +_ma_template_trans_matrix.tr_vector[1] 0.0 +_ma_template_trans_matrix.tr_vector[2] 0.0 +_ma_template_trans_matrix.tr_vector[3] 0.0 +# +loop_ +_pdbx_audit_revision_details.data_content_type +_pdbx_audit_revision_details.description +_pdbx_audit_revision_details.ordinal +_pdbx_audit_revision_details.provider +_pdbx_audit_revision_details.revision_ordinal +_pdbx_audit_revision_details.type +"Structure model" "Format fixes, new metadata, initial UniProt release" 3 repository 3 Remediation +"Structure model" "Improved prediction accuracy, small format fixes" 4 repository 4 Remediation +# +loop_ +_pdbx_audit_revision_history.data_content_type +_pdbx_audit_revision_history.major_revision +_pdbx_audit_revision_history.minor_revision +_pdbx_audit_revision_history.ordinal +_pdbx_audit_revision_history.revision_date +"Structure model" 3 0 3 2022-06-01 +"Structure model" 4 0 4 2022-09-30 +# +loop_ +_pdbx_data_usage.details +_pdbx_data_usage.id +_pdbx_data_usage.name +_pdbx_data_usage.type +_pdbx_data_usage.url +"Data in this file is available under a CC-BY-4.0 license." 1 CC-BY-4.0 license https://creativecommons.org/licenses/by/4.0/ +;ALPHAFOLD DATA, COPYRIGHT (2021) DEEPMIND TECHNOLOGIES LIMITED. THE INFORMATION +PROVIDED IS THEORETICAL MODELLING ONLY AND CAUTION SHOULD BE EXERCISED IN ITS +USE. IT IS PROVIDED "AS-IS" WITHOUT ANY WARRANTY OF ANY KIND, WHETHER EXPRESSED +OR IMPLIED. NO WARRANTY IS GIVEN THAT USE OF THE INFORMATION SHALL NOT INFRINGE +THE RIGHTS OF ANY THIRD PARTY. DISCLAIMER: THE INFORMATION IS NOT INTENDED TO BE +A SUBSTITUTE FOR PROFESSIONAL MEDICAL ADVICE, DIAGNOSIS, OR TREATMENT, AND DOES +NOT CONSTITUTE MEDICAL OR OTHER PROFESSIONAL ADVICE. IT IS AVAILABLE FOR +ACADEMIC AND COMMERCIAL PURPOSES, UNDER CC-BY 4.0 LICENCE. +; +2 ? disclaimer ? +# +_pdbx_database_status.entry_id AF-V9WDR2-F1 +_pdbx_database_status.recvd_initial_deposition_date 2022-06-01 +_pdbx_database_status.status_code REL +# +loop_ +_pdbx_poly_seq_scheme.asym_id +_pdbx_poly_seq_scheme.auth_seq_num +_pdbx_poly_seq_scheme.entity_id +_pdbx_poly_seq_scheme.hetero +_pdbx_poly_seq_scheme.mon_id +_pdbx_poly_seq_scheme.pdb_ins_code +_pdbx_poly_seq_scheme.pdb_mon_id +_pdbx_poly_seq_scheme.pdb_seq_num +_pdbx_poly_seq_scheme.pdb_strand_id +_pdbx_poly_seq_scheme.seq_id +A 1 1 n MET . MET 1 A 1 +A 2 1 n ILE . ILE 2 A 2 +A 3 1 n MET . MET 3 A 3 +A 4 1 n LYS . LYS 4 A 4 +A 5 1 n ASN . ASN 5 A 5 +A 6 1 n LYS . LYS 6 A 6 +A 7 1 n ASN . ASN 7 A 7 +A 8 1 n LYS . LYS 8 A 8 +A 9 1 n GLN . GLN 9 A 9 +A 10 1 n ASN . ASN 10 A 10 +A 11 1 n ARG . ARG 11 A 11 +A 12 1 n LYS . LYS 12 A 12 +A 13 1 n ALA . ALA 13 A 13 +A 14 1 n PHE . PHE 14 A 14 +A 15 1 n ALA . ALA 15 A 15 +A 16 1 n ASP . ASP 16 A 16 +A 17 1 n THR . THR 17 A 17 +A 18 1 n GLU . GLU 18 A 18 +A 19 1 n PHE . PHE 19 A 19 +A 20 1 n ALA . ALA 20 A 20 +A 21 1 n SER . SER 21 A 21 +A 22 1 n GLU . GLU 22 A 22 +A 23 1 n ALA . ALA 23 A 23 +A 24 1 n GLY . GLY 24 A 24 +A 25 1 n ALA . ALA 25 A 25 +A 26 1 n ASN . ASN 26 A 26 +A 27 1 n ARG . ARG 27 A 27 +A 28 1 n THR . THR 28 A 28 +A 29 1 n ALA . ALA 29 A 29 +A 30 1 n ALA . ALA 30 A 30 +A 31 1 n ASP . ASP 31 A 31 +A 32 1 n THR . THR 32 A 32 +A 33 1 n GLU . GLU 33 A 33 +A 34 1 n PHE . PHE 34 A 34 +A 35 1 n ALA . ALA 35 A 35 +A 36 1 n SER . SER 36 A 36 +A 37 1 n GLU . GLU 37 A 37 +A 38 1 n ALA . ALA 38 A 38 +A 39 1 n GLY . GLY 39 A 39 +A 40 1 n ALA . ALA 40 A 40 +A 41 1 n ASN . ASN 41 A 41 +A 42 1 n ARG . ARG 42 A 42 +A 43 1 n THR . THR 43 A 43 +A 44 1 n VAL . VAL 44 A 44 +A 45 1 n ALA . ALA 45 A 45 +A 46 1 n ASP . ASP 46 A 46 +A 47 1 n THR . THR 47 A 47 +A 48 1 n GLU . GLU 48 A 48 +A 49 1 n PHE . PHE 49 A 49 +A 50 1 n ALA . ALA 50 A 50 +A 51 1 n SER . SER 51 A 51 +A 52 1 n GLU . GLU 52 A 52 +A 53 1 n ALA . ALA 53 A 53 +A 54 1 n GLY . GLY 54 A 54 +A 55 1 n ALA . ALA 55 A 55 +A 56 1 n ASN . ASN 56 A 56 +A 57 1 n THR . THR 57 A 57 +A 58 1 n THR . THR 58 A 58 +A 59 1 n ALA . ALA 59 A 59 +A 60 1 n ALA . ALA 60 A 60 +A 61 1 n ASP . ASP 61 A 61 +A 62 1 n THR . THR 62 A 62 +A 63 1 n GLU . GLU 63 A 63 +A 64 1 n PHE . PHE 64 A 64 +A 65 1 n ALA . ALA 65 A 65 +A 66 1 n SER . SER 66 A 66 +A 67 1 n GLU . GLU 67 A 67 +A 68 1 n ALA . ALA 68 A 68 +A 69 1 n GLY . GLY 69 A 69 +A 70 1 n ALA . ALA 70 A 70 +A 71 1 n ASN . ASN 71 A 71 +A 72 1 n ARG . ARG 72 A 72 +A 73 1 n THR . THR 73 A 73 +A 74 1 n ALA . ALA 74 A 74 +A 75 1 n ALA . ALA 75 A 75 +A 76 1 n ASP . ASP 76 A 76 +A 77 1 n THR . THR 77 A 77 +A 78 1 n GLU . GLU 78 A 78 +A 79 1 n PHE . PHE 79 A 79 +A 80 1 n ALA . ALA 80 A 80 +A 81 1 n SER . SER 81 A 81 +A 82 1 n GLU . GLU 82 A 82 +A 83 1 n ALA . ALA 83 A 83 +A 84 1 n GLY . GLY 84 A 84 +A 85 1 n ALA . ALA 85 A 85 +A 86 1 n ASN . ASN 86 A 86 +A 87 1 n ARG . ARG 87 A 87 +A 88 1 n THR . THR 88 A 88 +A 89 1 n ALA . ALA 89 A 89 +A 90 1 n ALA . ALA 90 A 90 +A 91 1 n ASP . ASP 91 A 91 +A 92 1 n THR . THR 92 A 92 +A 93 1 n GLU . GLU 93 A 93 +A 94 1 n PHE . PHE 94 A 94 +A 95 1 n ALA . ALA 95 A 95 +A 96 1 n SER . SER 96 A 96 +A 97 1 n GLU . GLU 97 A 97 +A 98 1 n ALA . ALA 98 A 98 +A 99 1 n GLY . GLY 99 A 99 +A 100 1 n ALA . ALA 100 A 100 +A 101 1 n ASN . ASN 101 A 101 +A 102 1 n THR . THR 102 A 102 +A 103 1 n THR . THR 103 A 103 +A 104 1 n ALA . ALA 104 A 104 +A 105 1 n ALA . ALA 105 A 105 +A 106 1 n ASP . ASP 106 A 106 +A 107 1 n THR . THR 107 A 107 +A 108 1 n GLU . GLU 108 A 108 +A 109 1 n PHE . PHE 109 A 109 +A 110 1 n ALA . ALA 110 A 110 +A 111 1 n SER . SER 111 A 111 +A 112 1 n GLU . GLU 112 A 112 +A 113 1 n ALA . ALA 113 A 113 +A 114 1 n GLY . GLY 114 A 114 +A 115 1 n ALA . ALA 115 A 115 +A 116 1 n ASN . ASN 116 A 116 +A 117 1 n ARG . ARG 117 A 117 +A 118 1 n THR . THR 118 A 118 +A 119 1 n ALA . ALA 119 A 119 +A 120 1 n ALA . ALA 120 A 120 +A 121 1 n ASP . ASP 121 A 121 +A 122 1 n THR . THR 122 A 122 +A 123 1 n GLU . GLU 123 A 123 +A 124 1 n PHE . PHE 124 A 124 +A 125 1 n ALA . ALA 125 A 125 +A 126 1 n SER . SER 126 A 126 +A 127 1 n GLU . GLU 127 A 127 +A 128 1 n VAL . VAL 128 A 128 +A 129 1 n ARG . ARG 129 A 129 +A 130 1 n ALA . ALA 130 A 130 +A 131 1 n ASN . ASN 131 A 131 +A 132 1 n ARG . ARG 132 A 132 +A 133 1 n THR . THR 133 A 133 +A 134 1 n SER . SER 134 A 134 +A 135 1 n ALA . ALA 135 A 135 +A 136 1 n ASP . ASP 136 A 136 +A 137 1 n THR . THR 137 A 137 +A 138 1 n GLU . GLU 138 A 138 +A 139 1 n PHE . PHE 139 A 139 +A 140 1 n ALA . ALA 140 A 140 +A 141 1 n ASN . ASN 141 A 141 +A 142 1 n GLU . GLU 142 A 142 +A 143 1 n VAL . VAL 143 A 143 +A 144 1 n THR . THR 144 A 144 +A 145 1 n SER . SER 145 A 145 +A 146 1 n LYS . LYS 146 A 146 +A 147 1 n GLN . GLN 147 A 147 +A 148 1 n ASN . ASN 148 A 148 +A 149 1 n ARG . ARG 149 A 149 +A 150 1 n CYS . CYS 150 A 150 +A 151 1 n GLY . GLY 151 A 151 +A 152 1 n HIS . HIS 152 A 152 +# +loop_ +_software.classification +_software.date +_software.description +_software.name +_software.pdbx_ordinal +_software.type +_software.version +other ? "Structure prediction" AlphaFold 1 package v2.0 +other ? "Secondary structure" dssp 2 library 4 +# +_struct_asym.entity_id 1 +_struct_asym.id A +# +loop_ +_struct_conf.beg_auth_asym_id +_struct_conf.beg_auth_comp_id +_struct_conf.beg_auth_seq_id +_struct_conf.beg_label_asym_id +_struct_conf.beg_label_comp_id +_struct_conf.beg_label_seq_id +_struct_conf.conf_type_id +_struct_conf.end_auth_asym_id +_struct_conf.end_auth_comp_id +_struct_conf.end_auth_seq_id +_struct_conf.end_label_asym_id +_struct_conf.end_label_comp_id +_struct_conf.end_label_seq_id +_struct_conf.id +_struct_conf.pdbx_beg_PDB_ins_code +_struct_conf.pdbx_end_PDB_ins_code +A ARG 11 A ARG 11 STRN A ALA 23 A ALA 23 STRN1 ? ? +A GLY 24 A GLY 24 BEND A GLY 24 A GLY 24 BEND1 ? ? +A ASN 26 A ASN 26 STRN A ALA 38 A ALA 38 STRN2 ? ? +A GLY 39 A GLY 39 BEND A GLY 39 A GLY 39 BEND2 ? ? +A ASN 41 A ASN 41 STRN A THR 43 A THR 43 STRN3 ? ? +A ALA 45 A ALA 45 BEND A ALA 45 A ALA 45 BEND3 ? ? +A ASP 46 A ASP 46 STRN A ALA 53 A ALA 53 STRN4 ? ? +A GLY 54 A GLY 54 BEND A GLY 54 A GLY 54 BEND4 ? ? +A ASN 56 A ASN 56 STRN A THR 58 A THR 58 STRN5 ? ? +A ALA 60 A ALA 60 BEND A ALA 60 A ALA 60 BEND5 ? ? +A ASP 61 A ASP 61 STRN A ALA 68 A ALA 68 STRN6 ? ? +A GLY 69 A GLY 69 BEND A GLY 69 A GLY 69 BEND6 ? ? +A ASN 71 A ASN 71 STRN A THR 73 A THR 73 STRN7 ? ? +A ALA 75 A ALA 75 BEND A ALA 75 A ALA 75 BEND7 ? ? +A ASP 76 A ASP 76 STRN A ALA 83 A ALA 83 STRN8 ? ? +A GLY 84 A GLY 84 BEND A GLY 84 A GLY 84 BEND8 ? ? +A ASN 86 A ASN 86 STRN A THR 88 A THR 88 STRN9 ? ? +A ALA 90 A ALA 90 BEND A ALA 90 A ALA 90 BEND9 ? ? +A ASP 91 A ASP 91 STRN A ALA 98 A ALA 98 STRN10 ? ? +A GLY 99 A GLY 99 BEND A GLY 99 A GLY 99 BEND10 ? ? +A ASN 101 A ASN 101 STRN A THR 103 A THR 103 STRN11 ? ? +A ALA 105 A ALA 105 BEND A ALA 105 A ALA 105 BEND11 ? ? +A ASP 106 A ASP 106 STRN A ALA 113 A ALA 113 STRN12 ? ? +A GLY 114 A GLY 114 BEND A GLY 114 A GLY 114 BEND12 ? ? +A ASN 116 A ASN 116 STRN A THR 118 A THR 118 STRN13 ? ? +A ALA 120 A ALA 120 BEND A ALA 120 A ALA 120 BEND13 ? ? +A ASP 121 A ASP 121 STRN A VAL 128 A VAL 128 STRN14 ? ? +A ARG 129 A ARG 129 BEND A ARG 129 A ARG 129 BEND14 ? ? +A ASN 131 A ASN 131 STRN A SER 134 A SER 134 STRN15 ? ? +A ALA 135 A ALA 135 BEND A ALA 135 A ALA 135 BEND15 ? ? +A ASP 136 A ASP 136 STRN A VAL 143 A VAL 143 STRN16 ? ? +A THR 144 A THR 144 BEND A THR 144 A THR 144 BEND16 ? ? +A LYS 146 A LYS 146 STRN A ARG 149 A ARG 149 STRN17 ? ? +A CYS 150 A CYS 150 HELX_LH_PP_P A GLY 151 A GLY 151 HELX_LH_PP_P1 ? ? +# +loop_ +_struct_conf_type.criteria +_struct_conf_type.id +DSSP STRN +DSSP BEND +DSSP HELX_LH_PP_P +# +_struct_ref.db_code V9WDR2_9BACL +_struct_ref.db_name UNP +_struct_ref.entity_id 1 +_struct_ref.id 1 +_struct_ref.pdbx_align_begin 1 +_struct_ref.pdbx_align_end 152 +_struct_ref.pdbx_db_accession V9WDR2 +_struct_ref.pdbx_db_isoform ? +_struct_ref.pdbx_seq_one_letter_code +;MIMKNKNKQNRKAFADTEFASEAGANRTAADTEFASEAGANRTVADTEFASEAGANTTAADTEFASEAGANRTAADTEFA +SEAGANRTAADTEFASEAGANTTAADTEFASEAGANRTAADTEFASEVRANRTSADTEFANEVTSKQNRCGH +; +# +_struct_ref_seq.align_id 1 +_struct_ref_seq.db_align_beg 1 +_struct_ref_seq.db_align_end 152 +_struct_ref_seq.pdbx_PDB_id_code AF-V9WDR2-F1 +_struct_ref_seq.pdbx_auth_seq_align_beg 1 +_struct_ref_seq.pdbx_auth_seq_align_end 152 +_struct_ref_seq.pdbx_db_accession V9WDR2 +_struct_ref_seq.pdbx_db_align_beg_ins_code ? +_struct_ref_seq.pdbx_db_align_end_ins_code ? +_struct_ref_seq.pdbx_seq_align_beg_ins_code ? +_struct_ref_seq.pdbx_seq_align_end_ins_code ? +_struct_ref_seq.pdbx_strand_id A +_struct_ref_seq.ref_id 1 +_struct_ref_seq.seq_align_beg 1 +_struct_ref_seq.seq_align_end 152 +# +loop_ +_atom_site.group_PDB +_atom_site.id +_atom_site.type_symbol +_atom_site.label_atom_id +_atom_site.label_alt_id +_atom_site.label_comp_id +_atom_site.label_asym_id +_atom_site.label_entity_id +_atom_site.label_seq_id +_atom_site.pdbx_PDB_ins_code +_atom_site.Cartn_x +_atom_site.Cartn_y +_atom_site.Cartn_z +_atom_site.occupancy +_atom_site.B_iso_or_equiv +_atom_site.pdbx_formal_charge +_atom_site.auth_seq_id +_atom_site.auth_comp_id +_atom_site.auth_asym_id +_atom_site.auth_atom_id +_atom_site.pdbx_PDB_model_num +_atom_site.pdbx_sifts_xref_db_acc +_atom_site.pdbx_sifts_xref_db_name +_atom_site.pdbx_sifts_xref_db_num +_atom_site.pdbx_sifts_xref_db_res +ATOM 1 N N . MET A 1 1 ? -4.984 -19.848 45.023 1.0 34.44 ? 1 MET A N 1 V9WDR2 UNP 1 M +ATOM 2 C CA . MET A 1 1 ? -4.373 -18.588 44.547 1.0 34.44 ? 1 MET A CA 1 V9WDR2 UNP 1 M +ATOM 3 C C . MET A 1 1 ? -4.055 -18.774 43.067 1.0 34.44 ? 1 MET A C 1 V9WDR2 UNP 1 M +ATOM 4 C CB . MET A 1 1 ? -3.142 -18.277 45.423 1.0 34.44 ? 1 MET A CB 1 V9WDR2 UNP 1 M +ATOM 5 O O . MET A 1 1 ? -3.075 -19.425 42.745 1.0 34.44 ? 1 MET A O 1 V9WDR2 UNP 1 M +ATOM 6 C CG . MET A 1 1 ? -2.706 -16.810 45.457 1.0 34.44 ? 1 MET A CG 1 V9WDR2 UNP 1 M +ATOM 7 S SD . MET A 1 1 ? -1.706 -16.488 46.937 1.0 34.44 ? 1 MET A SD 1 V9WDR2 UNP 1 M +ATOM 8 C CE . MET A 1 1 ? -1.283 -14.738 46.734 1.0 34.44 ? 1 MET A CE 1 V9WDR2 UNP 1 M +ATOM 9 N N . ILE A 1 2 ? -4.958 -18.367 42.169 1.0 38.03 ? 2 ILE A N 1 V9WDR2 UNP 2 I +ATOM 10 C CA . ILE A 1 2 ? -4.807 -18.602 40.723 1.0 38.03 ? 2 ILE A CA 1 V9WDR2 UNP 2 I +ATOM 11 C C . ILE A 1 2 ? -4.126 -17.371 40.130 1.0 38.03 ? 2 ILE A C 1 V9WDR2 UNP 2 I +ATOM 12 C CB . ILE A 1 2 ? -6.163 -18.933 40.049 1.0 38.03 ? 2 ILE A CB 1 V9WDR2 UNP 2 I +ATOM 13 O O . ILE A 1 2 ? -4.718 -16.292 40.093 1.0 38.03 ? 2 ILE A O 1 V9WDR2 UNP 2 I +ATOM 14 C CG1 . ILE A 1 2 ? -6.749 -20.233 40.653 1.0 38.03 ? 2 ILE A CG1 1 V9WDR2 UNP 2 I +ATOM 15 C CG2 . ILE A 1 2 ? -5.997 -19.071 38.522 1.0 38.03 ? 2 ILE A CG2 1 V9WDR2 UNP 2 I +ATOM 16 C CD1 . ILE A 1 2 ? -8.159 -20.585 40.161 1.0 38.03 ? 2 ILE A CD1 1 V9WDR2 UNP 2 I +ATOM 17 N N . MET A 1 3 ? -2.874 -17.527 39.701 1.0 39.03 ? 3 MET A N 1 V9WDR2 UNP 3 M +ATOM 18 C CA . MET A 1 3 ? -2.173 -16.510 38.922 1.0 39.03 ? 3 MET A CA 1 V9WDR2 UNP 3 M +ATOM 19 C C . MET A 1 3 ? -2.892 -16.363 37.579 1.0 39.03 ? 3 MET A C 1 V9WDR2 UNP 3 M +ATOM 20 C CB . MET A 1 3 ? -0.698 -16.894 38.716 1.0 39.03 ? 3 MET A CB 1 V9WDR2 UNP 3 M +ATOM 21 O O . MET A 1 3 ? -2.768 -17.209 36.696 1.0 39.03 ? 3 MET A O 1 V9WDR2 UNP 3 M +ATOM 22 C CG . MET A 1 3 ? 0.110 -16.899 40.016 1.0 39.03 ? 3 MET A CG 1 V9WDR2 UNP 3 M +ATOM 23 S SD . MET A 1 3 ? 1.854 -17.302 39.747 1.0 39.03 ? 3 MET A SD 1 V9WDR2 UNP 3 M +ATOM 24 C CE . MET A 1 3 ? 2.256 -18.070 41.338 1.0 39.03 ? 3 MET A CE 1 V9WDR2 UNP 3 M +ATOM 25 N N . LYS A 1 4 ? -3.683 -15.298 37.426 1.0 45.03 ? 4 LYS A N 1 V9WDR2 UNP 4 K +ATOM 26 C CA . LYS A 1 4 ? -4.209 -14.903 36.119 1.0 45.03 ? 4 LYS A CA 1 V9WDR2 UNP 4 K +ATOM 27 C C . LYS A 1 4 ? -3.031 -14.403 35.283 1.0 45.03 ? 4 LYS A C 1 V9WDR2 UNP 4 K +ATOM 28 C CB . LYS A 1 4 ? -5.328 -13.857 36.259 1.0 45.03 ? 4 LYS A CB 1 V9WDR2 UNP 4 K +ATOM 29 O O . LYS A 1 4 ? -2.419 -13.389 35.614 1.0 45.03 ? 4 LYS A O 1 V9WDR2 UNP 4 K +ATOM 30 C CG . LYS A 1 4 ? -6.620 -14.469 36.831 1.0 45.03 ? 4 LYS A CG 1 V9WDR2 UNP 4 K +ATOM 31 C CD . LYS A 1 4 ? -7.749 -13.429 36.904 1.0 45.03 ? 4 LYS A CD 1 V9WDR2 UNP 4 K +ATOM 32 C CE . LYS A 1 4 ? -9.048 -14.074 37.411 1.0 45.03 ? 4 LYS A CE 1 V9WDR2 UNP 4 K +ATOM 33 N NZ . LYS A 1 4 ? -10.164 -13.095 37.503 1.0 45.03 ? 4 LYS A NZ 1 V9WDR2 UNP 4 K +ATOM 34 N N . ASN A 1 5 ? -2.710 -15.155 34.235 1.0 42.38 ? 5 ASN A N 1 V9WDR2 UNP 5 N +ATOM 35 C CA . ASN A 1 5 ? -1.707 -14.825 33.232 1.0 42.38 ? 5 ASN A CA 1 V9WDR2 UNP 5 N +ATOM 36 C C . ASN A 1 5 ? -1.987 -13.418 32.662 1.0 42.38 ? 5 ASN A C 1 V9WDR2 UNP 5 N +ATOM 37 C CB . ASN A 1 5 ? -1.761 -15.948 32.173 1.0 42.38 ? 5 ASN A CB 1 V9WDR2 UNP 5 N +ATOM 38 O O . ASN A 1 5 ? -3.040 -13.181 32.071 1.0 42.38 ? 5 ASN A O 1 V9WDR2 UNP 5 N +ATOM 39 C CG . ASN A 1 5 ? -0.670 -15.851 31.125 1.0 42.38 ? 5 ASN A CG 1 V9WDR2 UNP 5 N +ATOM 40 N ND2 . ASN A 1 5 ? -0.554 -16.835 30.265 1.0 42.38 ? 5 ASN A ND2 1 V9WDR2 UNP 5 N +ATOM 41 O OD1 . ASN A 1 5 ? 0.077 -14.890 31.072 1.0 42.38 ? 5 ASN A OD1 1 V9WDR2 UNP 5 N +ATOM 42 N N . LYS A 1 6 ? -1.061 -12.476 32.886 1.0 47.50 ? 6 LYS A N 1 V9WDR2 UNP 6 K +ATOM 43 C CA . LYS A 1 6 ? -1.152 -11.066 32.465 1.0 47.50 ? 6 LYS A CA 1 V9WDR2 UNP 6 K +ATOM 44 C C . LYS A 1 6 ? -0.837 -10.848 30.974 1.0 47.50 ? 6 LYS A C 1 V9WDR2 UNP 6 K +ATOM 45 C CB . LYS A 1 6 ? -0.270 -10.174 33.365 1.0 47.50 ? 6 LYS A CB 1 V9WDR2 UNP 6 K +ATOM 46 O O . LYS A 1 6 ? -0.666 -9.703 30.564 1.0 47.50 ? 6 LYS A O 1 V9WDR2 UNP 6 K +ATOM 47 C CG . LYS A 1 6 ? -0.824 -9.952 34.782 1.0 47.50 ? 6 LYS A CG 1 V9WDR2 UNP 6 K +ATOM 48 C CD . LYS A 1 6 ? 0.055 -8.921 35.512 1.0 47.50 ? 6 LYS A CD 1 V9WDR2 UNP 6 K +ATOM 49 C CE . LYS A 1 6 ? -0.459 -8.609 36.922 1.0 47.50 ? 6 LYS A CE 1 V9WDR2 UNP 6 K +ATOM 50 N NZ . LYS A 1 6 ? 0.400 -7.596 37.592 1.0 47.50 ? 6 LYS A NZ 1 V9WDR2 UNP 6 K +ATOM 51 N N . ASN A 1 7 ? -0.805 -11.897 30.149 1.0 44.88 ? 7 ASN A N 1 V9WDR2 UNP 7 N +ATOM 52 C CA . ASN A 1 7 ? -0.631 -11.779 28.697 1.0 44.88 ? 7 ASN A CA 1 V9WDR2 UNP 7 N +ATOM 53 C C . ASN A 1 7 ? -1.951 -11.465 27.957 1.0 44.88 ? 7 ASN A C 1 V9WDR2 UNP 7 N +ATOM 54 C CB . ASN A 1 7 ? 0.119 -13.009 28.159 1.0 44.88 ? 7 ASN A CB 1 V9WDR2 UNP 7 N +ATOM 55 O O . ASN A 1 7 ? -2.340 -12.127 27.000 1.0 44.88 ? 7 ASN A O 1 V9WDR2 UNP 7 N +ATOM 56 C CG . ASN A 1 7 ? 0.746 -12.713 26.805 1.0 44.88 ? 7 ASN A CG 1 V9WDR2 UNP 7 N +ATOM 57 N ND2 . ASN A 1 7 ? 1.404 -13.671 26.199 1.0 44.88 ? 7 ASN A ND2 1 V9WDR2 UNP 7 N +ATOM 58 O OD1 . ASN A 1 7 ? 0.691 -11.607 26.300 1.0 44.88 ? 7 ASN A OD1 1 V9WDR2 UNP 7 N +ATOM 59 N N . LYS A 1 8 ? -2.686 -10.475 28.470 1.0 44.59 ? 8 LYS A N 1 V9WDR2 UNP 8 K +ATOM 60 C CA . LYS A 1 8 ? -3.946 -9.947 27.923 1.0 44.59 ? 8 LYS A CA 1 V9WDR2 UNP 8 K +ATOM 61 C C . LYS A 1 8 ? -3.755 -8.486 27.484 1.0 44.59 ? 8 LYS A C 1 V9WDR2 UNP 8 K +ATOM 62 C CB . LYS A 1 8 ? -5.083 -10.162 28.951 1.0 44.59 ? 8 LYS A CB 1 V9WDR2 UNP 8 K +ATOM 63 O O . LYS A 1 8 ? -4.651 -7.667 27.654 1.0 44.59 ? 8 LYS A O 1 V9WDR2 UNP 8 K +ATOM 64 C CG . LYS A 1 8 ? -6.322 -10.825 28.334 1.0 44.59 ? 8 LYS A CG 1 V9WDR2 UNP 8 K +ATOM 65 C CD . LYS A 1 8 ? -7.481 -10.870 29.340 1.0 44.59 ? 8 LYS A CD 1 V9WDR2 UNP 8 K +ATOM 66 C CE . LYS A 1 8 ? -8.605 -11.764 28.803 1.0 44.59 ? 8 LYS A CE 1 V9WDR2 UNP 8 K +ATOM 67 N NZ . LYS A 1 8 ? -9.854 -11.635 29.595 1.0 44.59 ? 8 LYS A NZ 1 V9WDR2 UNP 8 K +ATOM 68 N N . GLN A 1 9 ? -2.546 -8.142 27.041 1.0 48.12 ? 9 GLN A N 1 V9WDR2 UNP 9 Q +ATOM 69 C CA . GLN A 1 9 ? -2.172 -6.767 26.720 1.0 48.12 ? 9 GLN A CA 1 V9WDR2 UNP 9 Q +ATOM 70 C C . GLN A 1 9 ? -2.788 -6.366 25.371 1.0 48.12 ? 9 GLN A C 1 V9WDR2 UNP 9 Q +ATOM 71 C CB . GLN A 1 9 ? -0.639 -6.608 26.733 1.0 48.12 ? 9 GLN A CB 1 V9WDR2 UNP 9 Q +ATOM 72 O O . GLN A 1 9 ? -2.524 -7.004 24.358 1.0 48.12 ? 9 GLN A O 1 V9WDR2 UNP 9 Q +ATOM 73 C CG . GLN A 1 9 ? 0.026 -6.971 28.075 1.0 48.12 ? 9 GLN A CG 1 V9WDR2 UNP 9 Q +ATOM 74 C CD . GLN A 1 9 ? -0.430 -6.113 29.254 1.0 48.12 ? 9 GLN A CD 1 V9WDR2 UNP 9 Q +ATOM 75 N NE2 . GLN A 1 9 ? -0.540 -6.677 30.438 1.0 48.12 ? 9 GLN A NE2 1 V9WDR2 UNP 9 Q +ATOM 76 O OE1 . GLN A 1 9 ? -0.723 -4.938 29.153 1.0 48.12 ? 9 GLN A OE1 1 V9WDR2 UNP 9 Q +ATOM 77 N N . ASN A 1 10 ? -3.620 -5.322 25.405 1.0 55.12 ? 10 ASN A N 1 V9WDR2 UNP 10 N +ATOM 78 C CA . ASN A 1 10 ? -4.056 -4.505 24.270 1.0 55.12 ? 10 ASN A CA 1 V9WDR2 UNP 10 N +ATOM 79 C C . ASN A 1 10 ? -4.683 -5.232 23.075 1.0 55.12 ? 10 ASN A C 1 V9WDR2 UNP 10 N +ATOM 80 C CB . ASN A 1 10 ? -2.877 -3.606 23.838 1.0 55.12 ? 10 ASN A CB 1 V9WDR2 UNP 10 N +ATOM 81 O O . ASN A 1 10 ? -4.072 -5.297 22.026 1.0 55.12 ? 10 ASN A O 1 V9WDR2 UNP 10 N +ATOM 82 C CG . ASN A 1 10 ? -2.715 -2.368 24.685 1.0 55.12 ? 10 ASN A CG 1 V9WDR2 UNP 10 N +ATOM 83 N ND2 . ASN A 1 10 ? -1.611 -1.676 24.552 1.0 55.12 ? 10 ASN A ND2 1 V9WDR2 UNP 10 N +ATOM 84 O OD1 . ASN A 1 10 ? -3.587 -2.003 25.460 1.0 55.12 ? 10 ASN A OD1 1 V9WDR2 UNP 10 N +ATOM 85 N N . ARG A 1 11 ? -5.930 -5.700 23.174 1.0 56.03 ? 11 ARG A N 1 V9WDR2 UNP 11 R +ATOM 86 C CA . ARG A 1 11 ? -6.805 -5.787 21.990 1.0 56.03 ? 11 ARG A CA 1 V9WDR2 UNP 11 R +ATOM 87 C C . ARG A 1 11 ? -8.107 -5.073 22.307 1.0 56.03 ? 11 ARG A C 1 V9WDR2 UNP 11 R +ATOM 88 C CB . ARG A 1 11 ? -7.030 -7.234 21.513 1.0 56.03 ? 11 ARG A CB 1 V9WDR2 UNP 11 R +ATOM 89 O O . ARG A 1 11 ? -8.853 -5.528 23.173 1.0 56.03 ? 11 ARG A O 1 V9WDR2 UNP 11 R +ATOM 90 C CG . ARG A 1 11 ? -6.021 -7.624 20.420 1.0 56.03 ? 11 ARG A CG 1 V9WDR2 UNP 11 R +ATOM 91 C CD . ARG A 1 11 ? -6.353 -8.976 19.779 1.0 56.03 ? 11 ARG A CD 1 V9WDR2 UNP 11 R +ATOM 92 N NE . ARG A 1 11 ? -6.050 -10.107 20.680 1.0 56.03 ? 11 ARG A NE 1 V9WDR2 UNP 11 R +ATOM 93 N NH1 . ARG A 1 11 ? -6.962 -11.755 19.368 1.0 56.03 ? 11 ARG A NH1 1 V9WDR2 UNP 11 R +ATOM 94 N NH2 . ARG A 1 11 ? -5.897 -12.306 21.252 1.0 56.03 ? 11 ARG A NH2 1 V9WDR2 UNP 11 R +ATOM 95 C CZ . ARG A 1 11 ? -6.309 -11.379 20.432 1.0 56.03 ? 11 ARG A CZ 1 V9WDR2 UNP 11 R +ATOM 96 N N . LYS A 1 12 ? -8.332 -3.937 21.652 1.0 73.56 ? 12 LYS A N 1 V9WDR2 UNP 12 K +ATOM 97 C CA . LYS A 1 12 ? -9.582 -3.174 21.713 1.0 73.56 ? 12 LYS A CA 1 V9WDR2 UNP 12 K +ATOM 98 C C . LYS A 1 12 ? -10.297 -3.329 20.373 1.0 73.56 ? 12 LYS A C 1 V9WDR2 UNP 12 K +ATOM 99 C CB . LYS A 1 12 ? -9.298 -1.697 22.006 1.0 73.56 ? 12 LYS A CB 1 V9WDR2 UNP 12 K +ATOM 100 O O . LYS A 1 12 ? -9.627 -3.272 19.348 1.0 73.56 ? 12 LYS A O 1 V9WDR2 UNP 12 K +ATOM 101 C CG . LYS A 1 12 ? -8.531 -1.408 23.308 1.0 73.56 ? 12 LYS A CG 1 V9WDR2 UNP 12 K +ATOM 102 C CD . LYS A 1 12 ? -8.327 0.111 23.424 1.0 73.56 ? 12 LYS A CD 1 V9WDR2 UNP 12 K +ATOM 103 C CE . LYS A 1 12 ? -7.247 0.515 24.432 1.0 73.56 ? 12 LYS A CE 1 V9WDR2 UNP 12 K +ATOM 104 N NZ . LYS A 1 12 ? -6.620 1.803 24.021 1.0 73.56 ? 12 LYS A NZ 1 V9WDR2 UNP 12 K +ATOM 105 N N . ALA A 1 13 ? -11.607 -3.553 20.414 1.0 77.81 ? 13 ALA A N 1 V9WDR2 UNP 13 A +ATOM 106 C CA . ALA A 1 13 ? -12.470 -3.613 19.241 1.0 77.81 ? 13 ALA A CA 1 V9WDR2 UNP 13 A +ATOM 107 C C . ALA A 1 13 ? -13.385 -2.383 19.241 1.0 77.81 ? 13 ALA A C 1 V9WDR2 UNP 13 A +ATOM 108 C CB . ALA A 1 13 ? -13.250 -4.932 19.237 1.0 77.81 ? 13 ALA A CB 1 V9WDR2 UNP 13 A +ATOM 109 O O . ALA A 1 13 ? -14.021 -2.112 20.263 1.0 77.81 ? 13 ALA A O 1 V9WDR2 UNP 13 A +ATOM 110 N N . PHE A 1 14 ? -13.436 -1.660 18.128 1.0 80.12 ? 14 PHE A N 1 V9WDR2 UNP 14 F +ATOM 111 C CA . PHE A 1 14 ? -14.290 -0.488 17.927 1.0 80.12 ? 14 PHE A CA 1 V9WDR2 UNP 14 F +ATOM 112 C C . PHE A 1 14 ? -15.118 -0.675 16.653 1.0 80.12 ? 14 PHE A C 1 V9WDR2 UNP 14 F +ATOM 113 C CB . PHE A 1 14 ? -13.419 0.772 17.871 1.0 80.12 ? 14 PHE A CB 1 V9WDR2 UNP 14 F +ATOM 114 O O . PHE A 1 14 ? -14.660 -1.358 15.743 1.0 80.12 ? 14 PHE A O 1 V9WDR2 UNP 14 F +ATOM 115 C CG . PHE A 1 14 ? -12.605 1.007 19.132 1.0 80.12 ? 14 PHE A CG 1 V9WDR2 UNP 14 F +ATOM 116 C CD1 . PHE A 1 14 ? -13.190 1.651 20.236 1.0 80.12 ? 14 PHE A CD1 1 V9WDR2 UNP 14 F +ATOM 117 C CD2 . PHE A 1 14 ? -11.262 0.593 19.196 1.0 80.12 ? 14 PHE A CD2 1 V9WDR2 UNP 14 F +ATOM 118 C CE1 . PHE A 1 14 ? -12.431 1.908 21.391 1.0 80.12 ? 14 PHE A CE1 1 V9WDR2 UNP 14 F +ATOM 119 C CE2 . PHE A 1 14 ? -10.488 0.892 20.331 1.0 80.12 ? 14 PHE A CE2 1 V9WDR2 UNP 14 F +ATOM 120 C CZ . PHE A 1 14 ? -11.074 1.546 21.430 1.0 80.12 ? 14 PHE A CZ 1 V9WDR2 UNP 14 F +ATOM 121 N N . ALA A 1 15 ? -16.330 -0.119 16.612 1.0 80.38 ? 15 ALA A N 1 V9WDR2 UNP 15 A +ATOM 122 C CA . ALA A 1 15 ? -17.080 -0.025 15.361 1.0 80.38 ? 15 ALA A CA 1 V9WDR2 UNP 15 A +ATOM 123 C C . ALA A 1 15 ? -16.466 1.118 14.548 1.0 80.38 ? 15 ALA A C 1 V9WDR2 UNP 15 A +ATOM 124 C CB . ALA A 1 15 ? -18.579 0.117 15.656 1.0 80.38 ? 15 ALA A CB 1 V9WDR2 UNP 15 A +ATOM 125 O O . ALA A 1 15 ? -15.577 0.862 13.746 1.0 80.38 ? 15 ALA A O 1 V9WDR2 UNP 15 A +ATOM 126 N N . ASP A 1 16 ? -16.759 2.357 14.937 1.0 87.81 ? 16 ASP A N 1 V9WDR2 UNP 16 D +ATOM 127 C CA . ASP A 1 16 ? -16.306 3.541 14.206 1.0 87.81 ? 16 ASP A CA 1 V9WDR2 UNP 16 D +ATOM 128 C C . ASP A 1 16 ? -15.365 4.357 15.090 1.0 87.81 ? 16 ASP A C 1 V9WDR2 UNP 16 D +ATOM 129 C CB . ASP A 1 16 ? -17.507 4.379 13.735 1.0 87.81 ? 16 ASP A CB 1 V9WDR2 UNP 16 D +ATOM 130 O O . ASP A 1 16 ? -15.596 4.527 16.296 1.0 87.81 ? 16 ASP A O 1 V9WDR2 UNP 16 D +ATOM 131 C CG . ASP A 1 16 ? -18.658 3.534 13.173 1.0 87.81 ? 16 ASP A CG 1 V9WDR2 UNP 16 D +ATOM 132 O OD1 . ASP A 1 16 ? -18.384 2.448 12.626 1.0 87.81 ? 16 ASP A OD1 1 V9WDR2 UNP 16 D +ATOM 133 O OD2 . ASP A 1 16 ? -19.820 3.877 13.493 1.0 87.81 ? 16 ASP A OD2 1 V9WDR2 UNP 16 D +ATOM 134 N N . THR A 1 17 ? -14.263 4.830 14.516 1.0 90.19 ? 17 THR A N 1 V9WDR2 UNP 17 T +ATOM 135 C CA . THR A 1 17 ? -13.298 5.662 15.233 1.0 90.19 ? 17 THR A CA 1 V9WDR2 UNP 17 T +ATOM 136 C C . THR A 1 17 ? -12.857 6.849 14.395 1.0 90.19 ? 17 THR A C 1 V9WDR2 UNP 17 T +ATOM 137 C CB . THR A 1 17 ? -12.046 4.868 15.631 1.0 90.19 ? 17 THR A CB 1 V9WDR2 UNP 17 T +ATOM 138 O O . THR A 1 17 ? -12.113 6.686 13.447 1.0 90.19 ? 17 THR A O 1 V9WDR2 UNP 17 T +ATOM 139 C CG2 . THR A 1 17 ? -11.279 5.643 16.708 1.0 90.19 ? 17 THR A CG2 1 V9WDR2 UNP 17 T +ATOM 140 O OG1 . THR A 1 17 ? -12.384 3.591 16.145 1.0 90.19 ? 17 THR A OG1 1 V9WDR2 UNP 17 T +ATOM 141 N N . GLU A 1 18 ? -13.174 8.060 14.830 1.0 91.25 ? 18 GLU A N 1 V9WDR2 UNP 18 E +ATOM 142 C CA . GLU A 1 18 ? -12.619 9.270 14.205 1.0 91.25 ? 18 GLU A CA 1 V9WDR2 UNP 18 E +ATOM 143 C C . GLU A 1 18 ? -11.085 9.306 14.357 1.0 91.25 ? 18 GLU A C 1 V9WDR2 UNP 18 E +ATOM 144 C CB . GLU A 1 18 ? -13.241 10.495 14.883 1.0 91.25 ? 18 GLU A CB 1 V9WDR2 UNP 18 E +ATOM 145 O O . GLU A 1 18 ? -10.344 9.444 13.396 1.0 91.25 ? 18 GLU A O 1 V9WDR2 UNP 18 E +ATOM 146 C CG . GLU A 1 18 ? -14.773 10.540 14.818 1.0 91.25 ? 18 GLU A CG 1 V9WDR2 UNP 18 E +ATOM 147 C CD . GLU A 1 18 ? -15.318 11.115 13.510 1.0 91.25 ? 18 GLU A CD 1 V9WDR2 UNP 18 E +ATOM 148 O OE1 . GLU A 1 18 ? -16.140 10.402 12.892 1.0 91.25 ? 18 GLU A OE1 1 V9WDR2 UNP 18 E +ATOM 149 O OE2 . GLU A 1 18 ? -15.100 12.331 13.338 1.0 91.25 ? 18 GLU A OE2 1 V9WDR2 UNP 18 E +ATOM 150 N N . PHE A 1 19 ? -10.568 9.083 15.574 1.0 90.44 ? 19 PHE A N 1 V9WDR2 UNP 19 F +ATOM 151 C CA . PHE A 1 19 ? -9.128 9.149 15.850 1.0 90.44 ? 19 PHE A CA 1 V9WDR2 UNP 19 F +ATOM 152 C C . PHE A 1 19 ? -8.605 7.924 16.606 1.0 90.44 ? 19 PHE A C 1 V9WDR2 UNP 19 F +ATOM 153 C CB . PHE A 1 19 ? -8.798 10.447 16.602 1.0 90.44 ? 19 PHE A CB 1 V9WDR2 UNP 19 F +ATOM 154 O O . PHE A 1 19 ? -9.034 7.612 17.724 1.0 90.44 ? 19 PHE A O 1 V9WDR2 UNP 19 F +ATOM 155 C CG . PHE A 1 19 ? -9.130 11.707 15.826 1.0 90.44 ? 19 PHE A CG 1 V9WDR2 UNP 19 F +ATOM 156 C CD1 . PHE A 1 19 ? -8.223 12.210 14.874 1.0 90.44 ? 19 PHE A CD1 1 V9WDR2 UNP 19 F +ATOM 157 C CD2 . PHE A 1 19 ? -10.376 12.340 16.002 1.0 90.44 ? 19 PHE A CD2 1 V9WDR2 UNP 19 F +ATOM 158 C CE1 . PHE A 1 19 ? -8.568 13.325 14.090 1.0 90.44 ? 19 PHE A CE1 1 V9WDR2 UNP 19 F +ATOM 159 C CE2 . PHE A 1 19 ? -10.725 13.445 15.208 1.0 90.44 ? 19 PHE A CE2 1 V9WDR2 UNP 19 F +ATOM 160 C CZ . PHE A 1 19 ? -9.824 13.933 14.247 1.0 90.44 ? 19 PHE A CZ 1 V9WDR2 UNP 19 F +ATOM 161 N N . ALA A 1 20 ? -7.601 7.268 16.033 1.0 88.88 ? 20 ALA A N 1 V9WDR2 UNP 20 A +ATOM 162 C CA . ALA A 1 20 ? -6.832 6.195 16.640 1.0 88.88 ? 20 ALA A CA 1 V9WDR2 UNP 20 A +ATOM 163 C C . ALA A 1 20 ? -5.346 6.570 16.677 1.0 88.88 ? 20 ALA A C 1 V9WDR2 UNP 20 A +ATOM 164 C CB . ALA A 1 20 ? -7.075 4.904 15.849 1.0 88.88 ? 20 ALA A CB 1 V9WDR2 UNP 20 A +ATOM 165 O O . ALA A 1 20 ? -4.713 6.759 15.646 1.0 88.88 ? 20 ALA A O 1 V9WDR2 UNP 20 A +ATOM 166 N N . SER A 1 21 ? -4.766 6.638 17.875 1.0 92.38 ? 21 SER A N 1 V9WDR2 UNP 21 S +ATOM 167 C CA . SER A 1 21 ? -3.317 6.750 18.040 1.0 92.38 ? 21 SER A CA 1 V9WDR2 UNP 21 S +ATOM 168 C C . SER A 1 21 ? -2.840 5.690 19.017 1.0 92.38 ? 21 SER A C 1 V9WDR2 UNP 21 S +ATOM 169 C CB . SER A 1 21 ? -2.910 8.159 18.465 1.0 92.38 ? 21 SER A CB 1 V9WDR2 UNP 21 S +ATOM 170 O O . SER A 1 21 ? -3.323 5.624 20.150 1.0 92.38 ? 21 SER A O 1 V9WDR2 UNP 21 S +ATOM 171 O OG . SER A 1 21 ? -1.500 8.258 18.525 1.0 92.38 ? 21 SER A OG 1 V9WDR2 UNP 21 S +ATOM 172 N N . GLU A 1 22 ? -1.942 4.823 18.562 1.0 87.19 ? 22 GLU A N 1 V9WDR2 UNP 22 E +ATOM 173 C CA . GLU A 1 22 ? -1.471 3.676 19.331 1.0 87.19 ? 22 GLU A CA 1 V9WDR2 UNP 22 E +ATOM 174 C C . GLU A 1 22 ? 0.049 3.508 19.166 1.0 87.19 ? 22 GLU A C 1 V9WDR2 UNP 22 E +ATOM 175 C CB . GLU A 1 22 ? -2.247 2.404 18.925 1.0 87.19 ? 22 GLU A CB 1 V9WDR2 UNP 22 E +ATOM 176 O O . GLU A 1 22 ? 0.609 3.622 18.075 1.0 87.19 ? 22 GLU A O 1 V9WDR2 UNP 22 E +ATOM 177 C CG . GLU A 1 22 ? -3.749 2.344 19.333 1.0 87.19 ? 22 GLU A CG 1 V9WDR2 UNP 22 E +ATOM 178 C CD . GLU A 1 22 ? -4.070 2.157 20.842 1.0 87.19 ? 22 GLU A CD 1 V9WDR2 UNP 22 E +ATOM 179 O OE1 . GLU A 1 22 ? -5.277 2.091 21.225 1.0 87.19 ? 22 GLU A OE1 1 V9WDR2 UNP 22 E +ATOM 180 O OE2 . GLU A 1 22 ? -3.138 2.004 21.663 1.0 87.19 ? 22 GLU A OE2 1 V9WDR2 UNP 22 E +ATOM 181 N N . ALA A 1 23 ? 0.728 3.211 20.276 1.0 90.38 ? 23 ALA A N 1 V9WDR2 UNP 23 A +ATOM 182 C CA . ALA A 1 23 ? 2.153 2.899 20.300 1.0 90.38 ? 23 ALA A CA 1 V9WDR2 UNP 23 A +ATOM 183 C C . ALA A 1 23 ? 2.367 1.565 21.023 1.0 90.38 ? 23 ALA A C 1 V9WDR2 UNP 23 A +ATOM 184 C CB . ALA A 1 23 ? 2.927 4.057 20.942 1.0 90.38 ? 23 ALA A CB 1 V9WDR2 UNP 23 A +ATOM 185 O O . ALA A 1 23 ? 2.037 1.436 22.205 1.0 90.38 ? 23 ALA A O 1 V9WDR2 UNP 23 A +ATOM 186 N N . GLY A 1 24 ? 2.891 0.556 20.321 1.0 86.38 ? 24 GLY A N 1 V9WDR2 UNP 24 G +ATOM 187 C CA . GLY A 1 24 ? 3.130 -0.775 20.900 1.0 86.38 ? 24 GLY A CA 1 V9WDR2 UNP 24 G +ATOM 188 C C . GLY A 1 24 ? 1.865 -1.536 21.329 1.0 86.38 ? 24 GLY A C 1 V9WDR2 UNP 24 G +ATOM 189 O O . GLY A 1 24 ? 1.930 -2.383 22.224 1.0 86.38 ? 24 GLY A O 1 V9WDR2 UNP 24 G +ATOM 190 N N . ALA A 1 25 ? 0.703 -1.219 20.753 1.0 84.62 ? 25 ALA A N 1 V9WDR2 UNP 25 A +ATOM 191 C CA . ALA A 1 25 ? -0.584 -1.829 21.089 1.0 84.62 ? 25 ALA A CA 1 V9WDR2 UNP 25 A +ATOM 192 C C . ALA A 1 25 ? -1.178 -2.596 19.903 1.0 84.62 ? 25 ALA A C 1 V9WDR2 UNP 25 A +ATOM 193 C CB . ALA A 1 25 ? -1.533 -0.726 21.560 1.0 84.62 ? 25 ALA A CB 1 V9WDR2 UNP 25 A +ATOM 194 O O . ALA A 1 25 ? -0.813 -2.329 18.763 1.0 84.62 ? 25 ALA A O 1 V9WDR2 UNP 25 A +ATOM 195 N N . ASN A 1 26 ? -2.120 -3.513 20.170 1.0 89.00 ? 26 ASN A N 1 V9WDR2 UNP 26 N +ATOM 196 C CA . ASN A 1 26 ? -2.925 -4.107 19.107 1.0 89.00 ? 26 ASN A CA 1 V9WDR2 UNP 26 N +ATOM 197 C C . ASN A 1 26 ? -4.351 -3.542 19.108 1.0 89.00 ? 26 ASN A C 1 V9WDR2 UNP 26 N +ATOM 198 C CB . ASN A 1 26 ? -2.895 -5.646 19.095 1.0 89.00 ? 26 ASN A CB 1 V9WDR2 UNP 26 N +ATOM 199 O O . ASN A 1 26 ? -4.991 -3.397 20.159 1.0 89.00 ? 26 ASN A O 1 V9WDR2 UNP 26 N +ATOM 200 C CG . ASN A 1 26 ? -1.516 -6.259 19.227 1.0 89.00 ? 26 ASN A CG 1 V9WDR2 UNP 26 N +ATOM 201 N ND2 . ASN A 1 26 ? -1.418 -7.440 19.789 1.0 89.00 ? 26 ASN A ND2 1 V9WDR2 UNP 26 N +ATOM 202 O OD1 . ASN A 1 26 ? -0.499 -5.730 18.825 1.0 89.00 ? 26 ASN A OD1 1 V9WDR2 UNP 26 N +ATOM 203 N N . ARG A 1 27 ? -4.877 -3.274 17.915 1.0 88.31 ? 27 ARG A N 1 V9WDR2 UNP 27 R +ATOM 204 C CA . ARG A 1 27 ? -6.211 -2.705 17.721 1.0 88.31 ? 27 ARG A CA 1 V9WDR2 UNP 27 R +ATOM 205 C C . ARG A 1 27 ? -6.984 -3.457 16.647 1.0 88.31 ? 27 ARG A C 1 V9WDR2 UNP 27 R +ATOM 206 C CB . ARG A 1 27 ? -6.060 -1.212 17.389 1.0 88.31 ? 27 ARG A CB 1 V9WDR2 UNP 27 R +ATOM 207 O O . ARG A 1 27 ? -6.421 -3.899 15.652 1.0 88.31 ? 27 ARG A O 1 V9WDR2 UNP 27 R +ATOM 208 C CG . ARG A 1 27 ? -7.415 -0.504 17.263 1.0 88.31 ? 27 ARG A CG 1 V9WDR2 UNP 27 R +ATOM 209 C CD . ARG A 1 27 ? -7.223 0.979 16.960 1.0 88.31 ? 27 ARG A CD 1 V9WDR2 UNP 27 R +ATOM 210 N NE . ARG A 1 27 ? -8.528 1.663 16.945 1.0 88.31 ? 27 ARG A NE 1 V9WDR2 UNP 27 R +ATOM 211 N NH1 . ARG A 1 27 ? -8.137 3.200 18.617 1.0 88.31 ? 27 ARG A NH1 1 V9WDR2 UNP 27 R +ATOM 212 N NH2 . ARG A 1 27 ? -10.132 3.081 17.671 1.0 88.31 ? 27 ARG A NH2 1 V9WDR2 UNP 27 R +ATOM 213 C CZ . ARG A 1 27 ? -8.920 2.640 17.735 1.0 88.31 ? 27 ARG A CZ 1 V9WDR2 UNP 27 R +ATOM 214 N N . THR A 1 28 ? -8.288 -3.562 16.861 1.0 91.44 ? 28 THR A N 1 V9WDR2 UNP 28 T +ATOM 215 C CA . THR A 1 28 ? -9.250 -3.932 15.831 1.0 91.44 ? 28 THR A CA 1 V9WDR2 UNP 28 T +ATOM 216 C C . THR A 1 28 ? -10.310 -2.835 15.733 1.0 91.44 ? 28 THR A C 1 V9WDR2 UNP 28 T +ATOM 217 C CB . THR A 1 28 ? -9.848 -5.319 16.089 1.0 91.44 ? 28 THR A CB 1 V9WDR2 UNP 28 T +ATOM 218 O O . THR A 1 28 ? -10.817 -2.382 16.760 1.0 91.44 ? 28 THR A O 1 V9WDR2 UNP 28 T +ATOM 219 C CG2 . THR A 1 28 ? -10.705 -5.799 14.921 1.0 91.44 ? 28 THR A CG2 1 V9WDR2 UNP 28 T +ATOM 220 O OG1 . THR A 1 28 ? -8.810 -6.267 16.264 1.0 91.44 ? 28 THR A OG1 1 V9WDR2 UNP 28 T +ATOM 221 N N . ALA A 1 29 ? -10.634 -2.382 14.532 1.0 90.12 ? 29 ALA A N 1 V9WDR2 UNP 29 A +ATOM 222 C CA . ALA A 1 29 ? -11.752 -1.472 14.280 1.0 90.12 ? 29 ALA A CA 1 V9WDR2 UNP 29 A +ATOM 223 C C . ALA A 1 29 ? -12.519 -1.935 13.032 1.0 90.12 ? 29 ALA A C 1 V9WDR2 UNP 29 A +ATOM 224 C CB . ALA A 1 29 ? -11.230 -0.033 14.181 1.0 90.12 ? 29 ALA A CB 1 V9WDR2 UNP 29 A +ATOM 225 O O . ALA A 1 29 ? -11.959 -2.707 12.257 1.0 90.12 ? 29 ALA A O 1 V9WDR2 UNP 29 A +ATOM 226 N N . ALA A 1 30 ? -13.779 -1.528 12.866 1.0 90.31 ? 30 ALA A N 1 V9WDR2 UNP 30 A +ATOM 227 C CA . ALA A 1 30 ? -14.408 -1.606 11.550 1.0 90.31 ? 30 ALA A CA 1 V9WDR2 UNP 30 A +ATOM 228 C C . ALA A 1 30 ? -13.888 -0.427 10.728 1.0 90.31 ? 30 ALA A C 1 V9WDR2 UNP 30 A +ATOM 229 C CB . ALA A 1 30 ? -15.936 -1.679 11.664 1.0 90.31 ? 30 ALA A CB 1 V9WDR2 UNP 30 A +ATOM 230 O O . ALA A 1 30 ? -13.056 -0.645 9.857 1.0 90.31 ? 30 ALA A O 1 V9WDR2 UNP 30 A +ATOM 231 N N . ASP A 1 31 ? -14.191 0.794 11.169 1.0 92.75 ? 31 ASP A N 1 V9WDR2 UNP 31 D +ATOM 232 C CA . ASP A 1 31 ? -13.874 2.006 10.419 1.0 92.75 ? 31 ASP A CA 1 V9WDR2 UNP 31 D +ATOM 233 C C . ASP A 1 31 ? -12.980 2.934 11.243 1.0 92.75 ? 31 ASP A C 1 V9WDR2 UNP 31 D +ATOM 234 C CB . ASP A 1 31 ? -15.175 2.693 9.969 1.0 92.75 ? 31 ASP A CB 1 V9WDR2 UNP 31 D +ATOM 235 O O . ASP A 1 31 ? -13.087 3.039 12.478 1.0 92.75 ? 31 ASP A O 1 V9WDR2 UNP 31 D +ATOM 236 C CG . ASP A 1 31 ? -16.095 1.750 9.175 1.0 92.75 ? 31 ASP A CG 1 V9WDR2 UNP 31 D +ATOM 237 O OD1 . ASP A 1 31 ? -15.565 0.793 8.574 1.0 92.75 ? 31 ASP A OD1 1 V9WDR2 UNP 31 D +ATOM 238 O OD2 . ASP A 1 31 ? -17.328 1.926 9.269 1.0 92.75 ? 31 ASP A OD2 1 V9WDR2 UNP 31 D +ATOM 239 N N . THR A 1 32 ? -12.030 3.595 10.586 1.0 95.44 ? 32 THR A N 1 V9WDR2 UNP 32 T +ATOM 240 C CA . THR A 1 32 ? -11.206 4.628 11.219 1.0 95.44 ? 32 THR A CA 1 V9WDR2 UNP 32 T +ATOM 241 C C . THR A 1 32 ? -10.917 5.780 10.267 1.0 95.44 ? 32 THR A C 1 V9WDR2 UNP 32 T +ATOM 242 C CB . THR A 1 32 ? -9.897 4.046 11.761 1.0 95.44 ? 32 THR A CB 1 V9WDR2 UNP 32 T +ATOM 243 O O . THR A 1 32 ? -10.283 5.567 9.248 1.0 95.44 ? 32 THR A O 1 V9WDR2 UNP 32 T +ATOM 244 C CG2 . THR A 1 32 ? -9.020 5.065 12.488 1.0 95.44 ? 32 THR A CG2 1 V9WDR2 UNP 32 T +ATOM 245 O OG1 . THR A 1 32 ? -10.163 3.009 12.693 1.0 95.44 ? 32 THR A OG1 1 V9WDR2 UNP 32 T +ATOM 246 N N . GLU A 1 33 ? -11.293 7.002 10.625 1.0 95.38 ? 33 GLU A N 1 V9WDR2 UNP 33 E +ATOM 247 C CA . GLU A 1 33 ? -10.997 8.183 9.799 1.0 95.38 ? 33 GLU A CA 1 V9WDR2 UNP 33 E +ATOM 248 C C . GLU A 1 33 ? -9.491 8.497 9.851 1.0 95.38 ? 33 GLU A C 1 V9WDR2 UNP 33 E +ATOM 249 C CB . GLU A 1 33 ? -11.855 9.349 10.302 1.0 95.38 ? 33 GLU A CB 1 V9WDR2 UNP 33 E +ATOM 250 O O . GLU A 1 33 ? -8.803 8.483 8.839 1.0 95.38 ? 33 GLU A O 1 V9WDR2 UNP 33 E +ATOM 251 C CG . GLU A 1 33 ? -12.002 10.508 9.306 1.0 95.38 ? 33 GLU A CG 1 V9WDR2 UNP 33 E +ATOM 252 C CD . GLU A 1 33 ? -12.645 11.751 9.949 1.0 95.38 ? 33 GLU A CD 1 V9WDR2 UNP 33 E +ATOM 253 O OE1 . GLU A 1 33 ? -12.783 12.802 9.277 1.0 95.38 ? 33 GLU A OE1 1 V9WDR2 UNP 33 E +ATOM 254 O OE2 . GLU A 1 33 ? -12.889 11.703 11.178 1.0 95.38 ? 33 GLU A OE2 1 V9WDR2 UNP 33 E +ATOM 255 N N . PHE A 1 34 ? -8.925 8.649 11.054 1.0 95.44 ? 34 PHE A N 1 V9WDR2 UNP 34 F +ATOM 256 C CA . PHE A 1 34 ? -7.506 8.954 11.249 1.0 95.44 ? 34 PHE A CA 1 V9WDR2 UNP 34 F +ATOM 257 C C . PHE A 1 34 ? -6.802 7.932 12.144 1.0 95.44 ? 34 PHE A C 1 V9WDR2 UNP 34 F +ATOM 258 C CB . PHE A 1 34 ? -7.361 10.364 11.828 1.0 95.44 ? 34 PHE A CB 1 V9WDR2 UNP 34 F +ATOM 259 O O . PHE A 1 34 ? -7.110 7.792 13.332 1.0 95.44 ? 34 PHE A O 1 V9WDR2 UNP 34 F +ATOM 260 C CG . PHE A 1 34 ? -7.950 11.462 10.967 1.0 95.44 ? 34 PHE A CG 1 V9WDR2 UNP 34 F +ATOM 261 C CD1 . PHE A 1 34 ? -7.235 11.954 9.860 1.0 95.44 ? 34 PHE A CD1 1 V9WDR2 UNP 34 F +ATOM 262 C CD2 . PHE A 1 34 ? -9.223 11.984 11.260 1.0 95.44 ? 34 PHE A CD2 1 V9WDR2 UNP 34 F +ATOM 263 C CE1 . PHE A 1 34 ? -7.802 12.941 9.035 1.0 95.44 ? 34 PHE A CE1 1 V9WDR2 UNP 34 F +ATOM 264 C CE2 . PHE A 1 34 ? -9.767 12.998 10.460 1.0 95.44 ? 34 PHE A CE2 1 V9WDR2 UNP 34 F +ATOM 265 C CZ . PHE A 1 34 ? -9.076 13.453 9.328 1.0 95.44 ? 34 PHE A CZ 1 V9WDR2 UNP 34 F +ATOM 266 N N . ALA A 1 35 ? -5.780 7.269 11.608 1.0 94.94 ? 35 ALA A N 1 V9WDR2 UNP 35 A +ATOM 267 C CA . ALA A 1 35 ? -4.913 6.338 12.318 1.0 94.94 ? 35 ALA A CA 1 V9WDR2 UNP 35 A +ATOM 268 C C . ALA A 1 35 ? -3.453 6.820 12.329 1.0 94.94 ? 35 ALA A C 1 V9WDR2 UNP 35 A +ATOM 269 C CB . ALA A 1 35 ? -5.062 4.942 11.705 1.0 94.94 ? 35 ALA A CB 1 V9WDR2 UNP 35 A +ATOM 270 O O . ALA A 1 35 ? -2.875 7.158 11.297 1.0 94.94 ? 35 ALA A O 1 V9WDR2 UNP 35 A +ATOM 271 N N . SER A 1 36 ? -2.830 6.810 13.508 1.0 96.62 ? 36 SER A N 1 V9WDR2 UNP 36 S +ATOM 272 C CA . SER A 1 36 ? -1.396 7.048 13.676 1.0 96.62 ? 36 SER A CA 1 V9WDR2 UNP 36 S +ATOM 273 C C . SER A 1 36 ? -0.776 5.978 14.567 1.0 96.62 ? 36 SER A C 1 V9WDR2 UNP 36 S +ATOM 274 C CB . SER A 1 36 ? -1.140 8.448 14.227 1.0 96.62 ? 36 SER A CB 1 V9WDR2 UNP 36 S +ATOM 275 O O . SER A 1 36 ? -1.115 5.860 15.748 1.0 96.62 ? 36 SER A O 1 V9WDR2 UNP 36 S +ATOM 276 O OG . SER A 1 36 ? 0.253 8.685 14.325 1.0 96.62 ? 36 SER A OG 1 V9WDR2 UNP 36 S +ATOM 277 N N . GLU A 1 37 ? 0.142 5.198 14.004 1.0 94.25 ? 37 GLU A N 1 V9WDR2 UNP 37 E +ATOM 278 C CA . GLU A 1 37 ? 0.661 3.993 14.642 1.0 94.25 ? 37 GLU A CA 1 V9WDR2 UNP 37 E +ATOM 279 C C . GLU A 1 37 ? 2.183 3.947 14.671 1.0 94.25 ? 37 GLU A C 1 V9WDR2 UNP 37 E +ATOM 280 C CB . GLU A 1 37 ? 0.114 2.747 13.952 1.0 94.25 ? 37 GLU A CB 1 V9WDR2 UNP 37 E +ATOM 281 O O . GLU A 1 37 ? 2.854 4.136 13.659 1.0 94.25 ? 37 GLU A O 1 V9WDR2 UNP 37 E +ATOM 282 C CG . GLU A 1 37 ? -1.417 2.725 13.998 1.0 94.25 ? 37 GLU A CG 1 V9WDR2 UNP 37 E +ATOM 283 C CD . GLU A 1 37 ? -2.005 1.322 13.948 1.0 94.25 ? 37 GLU A CD 1 V9WDR2 UNP 37 E +ATOM 284 O OE1 . GLU A 1 37 ? -3.127 1.206 14.490 1.0 94.25 ? 37 GLU A OE1 1 V9WDR2 UNP 37 E +ATOM 285 O OE2 . GLU A 1 37 ? -1.333 0.369 13.494 1.0 94.25 ? 37 GLU A OE2 1 V9WDR2 UNP 37 E +ATOM 286 N N . ALA A 1 38 ? 2.734 3.634 15.844 1.0 95.38 ? 38 ALA A N 1 V9WDR2 UNP 38 A +ATOM 287 C CA . ALA A 1 38 ? 4.167 3.443 16.030 1.0 95.38 ? 38 ALA A CA 1 V9WDR2 UNP 38 A +ATOM 288 C C . ALA A 1 38 ? 4.447 2.092 16.698 1.0 95.38 ? 38 ALA A C 1 V9WDR2 UNP 38 A +ATOM 289 C CB . ALA A 1 38 ? 4.733 4.628 16.817 1.0 95.38 ? 38 ALA A CB 1 V9WDR2 UNP 38 A +ATOM 290 O O . ALA A 1 38 ? 4.137 1.890 17.876 1.0 95.38 ? 38 ALA A O 1 V9WDR2 UNP 38 A +ATOM 291 N N . GLY A 1 39 ? 5.029 1.144 15.960 1.0 92.50 ? 39 GLY A N 1 V9WDR2 UNP 39 G +ATOM 292 C CA . GLY A 1 39 ? 5.297 -0.199 16.491 1.0 92.50 ? 39 GLY A CA 1 V9WDR2 UNP 39 G +ATOM 293 C C . GLY A 1 39 ? 4.040 -0.951 16.950 1.0 92.50 ? 39 GLY A C 1 V9WDR2 UNP 39 G +ATOM 294 O O . GLY A 1 39 ? 4.124 -1.775 17.862 1.0 92.50 ? 39 GLY A O 1 V9WDR2 UNP 39 G +ATOM 295 N N . ALA A 1 40 ? 2.872 -0.609 16.405 1.0 92.38 ? 40 ALA A N 1 V9WDR2 UNP 40 A +ATOM 296 C CA . ALA A 1 40 ? 1.581 -1.194 16.757 1.0 92.38 ? 40 ALA A CA 1 V9WDR2 UNP 40 A +ATOM 297 C C . ALA A 1 40 ? 1.172 -2.281 15.748 1.0 92.38 ? 40 ALA A C 1 V9WDR2 UNP 40 A +ATOM 298 C CB . ALA A 1 40 ? 0.554 -0.060 16.850 1.0 92.38 ? 40 ALA A CB 1 V9WDR2 UNP 40 A +ATOM 299 O O . ALA A 1 40 ? 1.777 -2.397 14.682 1.0 92.38 ? 40 ALA A O 1 V9WDR2 UNP 40 A +ATOM 300 N N . ASN A 1 41 ? 0.156 -3.080 16.093 1.0 93.56 ? 41 ASN A N 1 V9WDR2 UNP 41 N +ATOM 301 C CA . ASN A 1 41 ? -0.509 -3.948 15.122 1.0 93.56 ? 41 ASN A CA 1 V9WDR2 UNP 41 N +ATOM 302 C C . ASN A 1 41 ? -1.987 -3.578 14.988 1.0 93.56 ? 41 ASN A C 1 V9WDR2 UNP 41 N +ATOM 303 C CB . ASN A 1 41 ? -0.353 -5.441 15.454 1.0 93.56 ? 41 ASN A CB 1 V9WDR2 UNP 41 N +ATOM 304 O O . ASN A 1 41 ? -2.717 -3.607 15.986 1.0 93.56 ? 41 ASN A O 1 V9WDR2 UNP 41 N +ATOM 305 C CG . ASN A 1 41 ? 1.080 -5.887 15.657 1.0 93.56 ? 41 ASN A CG 1 V9WDR2 UNP 41 N +ATOM 306 N ND2 . ASN A 1 41 ? 1.442 -6.267 16.856 1.0 93.56 ? 41 ASN A ND2 1 V9WDR2 UNP 41 N +ATOM 307 O OD1 . ASN A 1 41 ? 1.906 -5.933 14.767 1.0 93.56 ? 41 ASN A OD1 1 V9WDR2 UNP 41 N +ATOM 308 N N . ARG A 1 42 ? -2.465 -3.334 13.769 1.0 93.56 ? 42 ARG A N 1 V9WDR2 UNP 42 R +ATOM 309 C CA . ARG A 1 42 ? -3.877 -3.017 13.528 1.0 93.56 ? 42 ARG A CA 1 V9WDR2 UNP 42 R +ATOM 310 C C . ARG A 1 42 ? -4.527 -3.952 12.536 1.0 93.56 ? 42 ARG A C 1 V9WDR2 UNP 42 R +ATOM 311 C CB . ARG A 1 42 ? -4.034 -1.551 13.119 1.0 93.56 ? 42 ARG A CB 1 V9WDR2 UNP 42 R +ATOM 312 O O . ARG A 1 42 ? -3.950 -4.318 11.522 1.0 93.56 ? 42 ARG A O 1 V9WDR2 UNP 42 R +ATOM 313 C CG . ARG A 1 42 ? -5.504 -1.104 13.137 1.0 93.56 ? 42 ARG A CG 1 V9WDR2 UNP 42 R +ATOM 314 C CD . ARG A 1 42 ? -5.752 0.387 12.916 1.0 93.56 ? 42 ARG A CD 1 V9WDR2 UNP 42 R +ATOM 315 N NE . ARG A 1 42 ? -5.499 0.795 11.533 1.0 93.56 ? 42 ARG A NE 1 V9WDR2 UNP 42 R +ATOM 316 N NH1 . ARG A 1 42 ? -7.397 2.076 11.222 1.0 93.56 ? 42 ARG A NH1 1 V9WDR2 UNP 42 R +ATOM 317 N NH2 . ARG A 1 42 ? -6.008 1.741 9.553 1.0 93.56 ? 42 ARG A NH2 1 V9WDR2 UNP 42 R +ATOM 318 C CZ . ARG A 1 42 ? -6.298 1.532 10.792 1.0 93.56 ? 42 ARG A CZ 1 V9WDR2 UNP 42 R +ATOM 319 N N . THR A 1 43 ? -5.774 -4.282 12.832 1.0 95.69 ? 43 THR A N 1 V9WDR2 UNP 43 T +ATOM 320 C CA . THR A 1 43 ? -6.723 -4.792 11.849 1.0 95.69 ? 43 THR A CA 1 V9WDR2 UNP 43 T +ATOM 321 C C . THR A 1 43 ? -7.874 -3.804 11.745 1.0 95.69 ? 43 THR A C 1 V9WDR2 UNP 43 T +ATOM 322 C CB . THR A 1 43 ? -7.218 -6.189 12.223 1.0 95.69 ? 43 THR A CB 1 V9WDR2 UNP 43 T +ATOM 323 O O . THR A 1 43 ? -8.468 -3.448 12.764 1.0 95.69 ? 43 THR A O 1 V9WDR2 UNP 43 T +ATOM 324 C CG2 . THR A 1 43 ? -8.036 -6.823 11.103 1.0 95.69 ? 43 THR A CG2 1 V9WDR2 UNP 43 T +ATOM 325 O OG1 . THR A 1 43 ? -6.124 -7.042 12.490 1.0 95.69 ? 43 THR A OG1 1 V9WDR2 UNP 43 T +ATOM 326 N N . VAL A 1 44 ? -8.181 -3.351 10.544 1.0 94.94 ? 44 VAL A N 1 V9WDR2 UNP 44 V +ATOM 327 C CA . VAL A 1 44 ? -9.313 -2.473 10.255 1.0 94.94 ? 44 VAL A CA 1 V9WDR2 UNP 44 V +ATOM 328 C C . VAL A 1 44 ? -10.036 -2.998 9.015 1.0 94.94 ? 44 VAL A C 1 V9WDR2 UNP 44 V +ATOM 329 C CB . VAL A 1 44 ? -8.829 -1.022 10.135 1.0 94.94 ? 44 VAL A CB 1 V9WDR2 UNP 44 V +ATOM 330 O O . VAL A 1 44 ? -9.414 -3.726 8.243 1.0 94.94 ? 44 VAL A O 1 V9WDR2 UNP 44 V +ATOM 331 C CG1 . VAL A 1 44 ? -8.008 -0.815 8.860 1.0 94.94 ? 44 VAL A CG1 1 V9WDR2 UNP 44 V +ATOM 332 C CG2 . VAL A 1 44 ? -9.995 -0.043 10.222 1.0 94.94 ? 44 VAL A CG2 1 V9WDR2 UNP 44 V +ATOM 333 N N . ALA A 1 45 ? -11.322 -2.704 8.842 1.0 95.31 ? 45 ALA A N 1 V9WDR2 UNP 45 A +ATOM 334 C CA . ALA A 1 45 ? -11.922 -2.834 7.518 1.0 95.31 ? 45 ALA A CA 1 V9WDR2 UNP 45 A +ATOM 335 C C . ALA A 1 45 ? -11.460 -1.633 6.689 1.0 95.31 ? 45 ALA A C 1 V9WDR2 UNP 45 A +ATOM 336 C CB . ALA A 1 45 ? -13.445 -2.990 7.615 1.0 95.31 ? 45 ALA A CB 1 V9WDR2 UNP 45 A +ATOM 337 O O . ALA A 1 45 ? -10.574 -1.801 5.855 1.0 95.31 ? 45 ALA A O 1 V9WDR2 UNP 45 A +ATOM 338 N N . ASP A 1 46 ? -11.894 -0.430 7.066 1.0 96.00 ? 46 ASP A N 1 V9WDR2 UNP 46 D +ATOM 339 C CA . ASP A 1 46 ? -11.712 0.757 6.234 1.0 96.00 ? 46 ASP A CA 1 V9WDR2 UNP 46 D +ATOM 340 C C . ASP A 1 46 ? -10.944 1.855 6.971 1.0 96.00 ? 46 ASP A C 1 V9WDR2 UNP 46 D +ATOM 341 C CB . ASP A 1 46 ? -13.083 1.245 5.736 1.0 96.00 ? 46 ASP A CB 1 V9WDR2 UNP 46 D +ATOM 342 O O . ASP A 1 46 ? -11.102 2.082 8.182 1.0 96.00 ? 46 ASP A O 1 V9WDR2 UNP 46 D +ATOM 343 C CG . ASP A 1 46 ? -13.874 0.149 4.999 1.0 96.00 ? 46 ASP A CG 1 V9WDR2 UNP 46 D +ATOM 344 O OD1 . ASP A 1 46 ? -13.232 -0.800 4.498 1.0 96.00 ? 46 ASP A OD1 1 V9WDR2 UNP 46 D +ATOM 345 O OD2 . ASP A 1 46 ? -15.123 0.215 5.014 1.0 96.00 ? 46 ASP A OD2 1 V9WDR2 UNP 46 D +ATOM 346 N N . THR A 1 47 ? -10.053 2.553 6.267 1.0 97.12 ? 47 THR A N 1 V9WDR2 UNP 47 T +ATOM 347 C CA . THR A 1 47 ? -9.393 3.741 6.817 1.0 97.12 ? 47 THR A CA 1 V9WDR2 UNP 47 T +ATOM 348 C C . THR A 1 47 ? -9.164 4.841 5.808 1.0 97.12 ? 47 THR A C 1 V9WDR2 UNP 47 T +ATOM 349 C CB . THR A 1 47 ? -8.086 3.378 7.518 1.0 97.12 ? 47 THR A CB 1 V9WDR2 UNP 47 T +ATOM 350 O O . THR A 1 47 ? -8.559 4.617 4.769 1.0 97.12 ? 47 THR A O 1 V9WDR2 UNP 47 T +ATOM 351 C CG2 . THR A 1 47 ? -7.254 4.557 8.029 1.0 97.12 ? 47 THR A CG2 1 V9WDR2 UNP 47 T +ATOM 352 O OG1 . THR A 1 47 ? -8.454 2.633 8.655 1.0 97.12 ? 47 THR A OG1 1 V9WDR2 UNP 47 T +ATOM 353 N N . GLU A 1 48 ? -9.559 6.055 6.176 1.0 97.81 ? 48 GLU A N 1 V9WDR2 UNP 48 E +ATOM 354 C CA . GLU A 1 48 ? -9.361 7.228 5.326 1.0 97.81 ? 48 GLU A CA 1 V9WDR2 UNP 48 E +ATOM 355 C C . GLU A 1 48 ? -7.890 7.665 5.353 1.0 97.81 ? 48 GLU A C 1 V9WDR2 UNP 48 E +ATOM 356 C CB . GLU A 1 48 ? -10.320 8.338 5.778 1.0 97.81 ? 48 GLU A CB 1 V9WDR2 UNP 48 E +ATOM 357 O O . GLU A 1 48 ? -7.227 7.717 4.327 1.0 97.81 ? 48 GLU A O 1 V9WDR2 UNP 48 E +ATOM 358 C CG . GLU A 1 48 ? -10.580 9.355 4.663 1.0 97.81 ? 48 GLU A CG 1 V9WDR2 UNP 48 E +ATOM 359 C CD . GLU A 1 48 ? -11.533 10.483 5.089 1.0 97.81 ? 48 GLU A CD 1 V9WDR2 UNP 48 E +ATOM 360 O OE1 . GLU A 1 48 ? -11.513 11.575 4.469 1.0 97.81 ? 48 GLU A OE1 1 V9WDR2 UNP 48 E +ATOM 361 O OE2 . GLU A 1 48 ? -12.264 10.278 6.083 1.0 97.81 ? 48 GLU A OE2 1 V9WDR2 UNP 48 E +ATOM 362 N N . PHE A 1 49 ? -7.312 7.872 6.538 1.0 97.81 ? 49 PHE A N 1 V9WDR2 UNP 49 F +ATOM 363 C CA . PHE A 1 49 ? -5.925 8.311 6.692 1.0 97.81 ? 49 PHE A CA 1 V9WDR2 UNP 49 F +ATOM 364 C C . PHE A 1 49 ? -5.146 7.427 7.661 1.0 97.81 ? 49 PHE A C 1 V9WDR2 UNP 49 F +ATOM 365 C CB . PHE A 1 49 ? -5.896 9.768 7.164 1.0 97.81 ? 49 PHE A CB 1 V9WDR2 UNP 49 F +ATOM 366 O O . PHE A 1 49 ? -5.452 7.354 8.852 1.0 97.81 ? 49 PHE A O 1 V9WDR2 UNP 49 F +ATOM 367 C CG . PHE A 1 49 ? -6.559 10.749 6.220 1.0 97.81 ? 49 PHE A CG 1 V9WDR2 UNP 49 F +ATOM 368 C CD1 . PHE A 1 49 ? -5.848 11.272 5.123 1.0 97.81 ? 49 PHE A CD1 1 V9WDR2 UNP 49 F +ATOM 369 C CD2 . PHE A 1 49 ? -7.897 11.126 6.428 1.0 97.81 ? 49 PHE A CD2 1 V9WDR2 UNP 49 F +ATOM 370 C CE1 . PHE A 1 49 ? -6.483 12.148 4.225 1.0 97.81 ? 49 PHE A CE1 1 V9WDR2 UNP 49 F +ATOM 371 C CE2 . PHE A 1 49 ? -8.516 12.028 5.550 1.0 97.81 ? 49 PHE A CE2 1 V9WDR2 UNP 49 F +ATOM 372 C CZ . PHE A 1 49 ? -7.823 12.515 4.433 1.0 97.81 ? 49 PHE A CZ 1 V9WDR2 UNP 49 F +ATOM 373 N N . ALA A 1 50 ? -4.061 6.816 7.190 1.0 97.12 ? 50 ALA A N 1 V9WDR2 UNP 50 A +ATOM 374 C CA . ALA A 1 50 ? -3.180 5.980 7.995 1.0 97.12 ? 50 ALA A CA 1 V9WDR2 UNP 50 A +ATOM 375 C C . ALA A 1 50 ? -1.716 6.429 7.902 1.0 97.12 ? 50 ALA A C 1 V9WDR2 UNP 50 A +ATOM 376 C CB . ALA A 1 50 ? -3.371 4.524 7.569 1.0 97.12 ? 50 ALA A CB 1 V9WDR2 UNP 50 A +ATOM 377 O O . ALA A 1 50 ? -1.096 6.391 6.839 1.0 97.12 ? 50 ALA A O 1 V9WDR2 UNP 50 A +ATOM 378 N N . SER A 1 51 ? -1.134 6.793 9.047 1.0 98.19 ? 51 SER A N 1 V9WDR2 UNP 51 S +ATOM 379 C CA . SER A 1 51 ? 0.292 7.090 9.196 1.0 98.19 ? 51 SER A CA 1 V9WDR2 UNP 51 S +ATOM 380 C C . SER A 1 51 ? 0.963 6.060 10.100 1.0 98.19 ? 51 SER A C 1 V9WDR2 UNP 51 S +ATOM 381 C CB . SER A 1 51 ? 0.482 8.505 9.735 1.0 98.19 ? 51 SER A CB 1 V9WDR2 UNP 51 S +ATOM 382 O O . SER A 1 51 ? 0.610 5.923 11.271 1.0 98.19 ? 51 SER A O 1 V9WDR2 UNP 51 S +ATOM 383 O OG . SER A 1 51 ? 1.860 8.827 9.789 1.0 98.19 ? 51 SER A OG 1 V9WDR2 UNP 51 S +ATOM 384 N N . GLU A 1 52 ? 1.942 5.338 9.565 1.0 97.38 ? 52 GLU A N 1 V9WDR2 UNP 52 E +ATOM 385 C CA . GLU A 1 52 ? 2.520 4.161 10.208 1.0 97.38 ? 52 GLU A CA 1 V9WDR2 UNP 52 E +ATOM 386 C C . GLU A 1 52 ? 4.045 4.220 10.242 1.0 97.38 ? 52 GLU A C 1 V9WDR2 UNP 52 E +ATOM 387 C CB . GLU A 1 52 ? 2.046 2.899 9.483 1.0 97.38 ? 52 GLU A CB 1 V9WDR2 UNP 52 E +ATOM 388 O O . GLU A 1 52 ? 4.708 4.421 9.225 1.0 97.38 ? 52 GLU A O 1 V9WDR2 UNP 52 E +ATOM 389 C CG . GLU A 1 52 ? 0.542 2.694 9.698 1.0 97.38 ? 52 GLU A CG 1 V9WDR2 UNP 52 E +ATOM 390 C CD . GLU A 1 52 ? -0.004 1.465 8.987 1.0 97.38 ? 52 GLU A CD 1 V9WDR2 UNP 52 E +ATOM 391 O OE1 . GLU A 1 52 ? -1.233 1.451 8.746 1.0 97.38 ? 52 GLU A OE1 1 V9WDR2 UNP 52 E +ATOM 392 O OE2 . GLU A 1 52 ? 0.766 0.538 8.666 1.0 97.38 ? 52 GLU A OE2 1 V9WDR2 UNP 52 E +ATOM 393 N N . ALA A 1 53 ? 4.615 4.001 11.425 1.0 97.81 ? 53 ALA A N 1 V9WDR2 UNP 53 A +ATOM 394 C CA . ALA A 1 53 ? 6.052 3.917 11.641 1.0 97.81 ? 53 ALA A CA 1 V9WDR2 UNP 53 A +ATOM 395 C C . ALA A 1 53 ? 6.403 2.605 12.350 1.0 97.81 ? 53 ALA A C 1 V9WDR2 UNP 53 A +ATOM 396 C CB . ALA A 1 53 ? 6.509 5.155 12.418 1.0 97.81 ? 53 ALA A CB 1 V9WDR2 UNP 53 A +ATOM 397 O O . ALA A 1 53 ? 6.111 2.422 13.535 1.0 97.81 ? 53 ALA A O 1 V9WDR2 UNP 53 A +ATOM 398 N N . GLY A 1 54 ? 7.029 1.667 11.637 1.0 96.44 ? 54 GLY A N 1 V9WDR2 UNP 54 G +ATOM 399 C CA . GLY A 1 54 ? 7.355 0.351 12.200 1.0 96.44 ? 54 GLY A CA 1 V9WDR2 UNP 54 G +ATOM 400 C C . GLY A 1 54 ? 6.139 -0.466 12.653 1.0 96.44 ? 54 GLY A C 1 V9WDR2 UNP 54 G +ATOM 401 O O . GLY A 1 54 ? 6.291 -1.339 13.507 1.0 96.44 ? 54 GLY A O 1 V9WDR2 UNP 54 G +ATOM 402 N N . ALA A 1 55 ? 4.940 -0.141 12.165 1.0 96.31 ? 55 ALA A N 1 V9WDR2 UNP 55 A +ATOM 403 C CA . ALA A 1 55 ? 3.699 -0.833 12.501 1.0 96.31 ? 55 ALA A CA 1 V9WDR2 UNP 55 A +ATOM 404 C C . ALA A 1 55 ? 3.449 -2.018 11.553 1.0 96.31 ? 55 ALA A C 1 V9WDR2 UNP 55 A +ATOM 405 C CB . ALA A 1 55 ? 2.549 0.182 12.487 1.0 96.31 ? 55 ALA A CB 1 V9WDR2 UNP 55 A +ATOM 406 O O . ALA A 1 55 ? 4.068 -2.102 10.492 1.0 96.31 ? 55 ALA A O 1 V9WDR2 UNP 55 A +ATOM 407 N N . ASN A 1 56 ? 2.551 -2.927 11.946 1.0 97.44 ? 56 ASN A N 1 V9WDR2 UNP 56 N +ATOM 408 C CA . ASN A 1 56 ? 2.006 -3.938 11.042 1.0 97.44 ? 56 ASN A CA 1 V9WDR2 UNP 56 N +ATOM 409 C C . ASN A 1 56 ? 0.494 -3.779 10.926 1.0 97.44 ? 56 ASN A C 1 V9WDR2 UNP 56 N +ATOM 410 C CB . ASN A 1 56 ? 2.349 -5.371 11.464 1.0 97.44 ? 56 ASN A CB 1 V9WDR2 UNP 56 N +ATOM 411 O O . ASN A 1 56 ? -0.217 -3.907 11.928 1.0 97.44 ? 56 ASN A O 1 V9WDR2 UNP 56 N +ATOM 412 C CG . ASN A 1 56 ? 3.816 -5.582 11.747 1.0 97.44 ? 56 ASN A CG 1 V9WDR2 UNP 56 N +ATOM 413 N ND2 . ASN A 1 56 ? 4.163 -5.822 12.987 1.0 97.44 ? 56 ASN A ND2 1 V9WDR2 UNP 56 N +ATOM 414 O OD1 . ASN A 1 56 ? 4.673 -5.563 10.882 1.0 97.44 ? 56 ASN A OD1 1 V9WDR2 UNP 56 N +ATOM 415 N N . THR A 1 57 ? -0.008 -3.561 9.720 1.0 96.94 ? 57 THR A N 1 V9WDR2 UNP 57 T +ATOM 416 C CA . THR A 1 57 ? -1.427 -3.289 9.515 1.0 96.94 ? 57 THR A CA 1 V9WDR2 UNP 57 T +ATOM 417 C C . THR A 1 57 ? -2.056 -4.202 8.484 1.0 96.94 ? 57 THR A C 1 V9WDR2 UNP 57 T +ATOM 418 C CB . THR A 1 57 ? -1.682 -1.808 9.230 1.0 96.94 ? 57 THR A CB 1 V9WDR2 UNP 57 T +ATOM 419 O O . THR A 1 57 ? -1.440 -4.642 7.516 1.0 96.94 ? 57 THR A O 1 V9WDR2 UNP 57 T +ATOM 420 C CG2 . THR A 1 57 ? -1.275 -1.017 10.480 1.0 96.94 ? 57 THR A CG2 1 V9WDR2 UNP 57 T +ATOM 421 O OG1 . THR A 1 57 ? -0.959 -1.413 8.089 1.0 96.94 ? 57 THR A OG1 1 V9WDR2 UNP 57 T +ATOM 422 N N . THR A 1 58 ? -3.310 -4.541 8.749 1.0 98.06 ? 58 THR A N 1 V9WDR2 UNP 58 T +ATOM 423 C CA . THR A 1 58 ? -4.194 -5.224 7.817 1.0 98.06 ? 58 THR A CA 1 V9WDR2 UNP 58 T +ATOM 424 C C . THR A 1 58 ? -5.445 -4.376 7.666 1.0 98.06 ? 58 THR A C 1 V9WDR2 UNP 58 T +ATOM 425 C CB . THR A 1 58 ? -4.529 -6.642 8.284 1.0 98.06 ? 58 THR A CB 1 V9WDR2 UNP 58 T +ATOM 426 O O . THR A 1 58 ? -6.126 -4.129 8.665 1.0 98.06 ? 58 THR A O 1 V9WDR2 UNP 58 T +ATOM 427 C CG2 . THR A 1 58 ? -5.327 -7.412 7.234 1.0 98.06 ? 58 THR A CG2 1 V9WDR2 UNP 58 T +ATOM 428 O OG1 . THR A 1 58 ? -3.342 -7.368 8.527 1.0 98.06 ? 58 THR A OG1 1 V9WDR2 UNP 58 T +ATOM 429 N N . ALA A 1 59 ? -5.722 -3.939 6.446 1.0 96.69 ? 59 ALA A N 1 V9WDR2 UNP 59 A +ATOM 430 C CA . ALA A 1 59 ? -6.935 -3.237 6.056 1.0 96.69 ? 59 ALA A CA 1 V9WDR2 UNP 59 A +ATOM 431 C C . ALA A 1 59 ? -7.640 -4.019 4.939 1.0 96.69 ? 59 ALA A C 1 V9WDR2 UNP 59 A +ATOM 432 C CB . ALA A 1 59 ? -6.578 -1.804 5.651 1.0 96.69 ? 59 ALA A CB 1 V9WDR2 UNP 59 A +ATOM 433 O O . ALA A 1 59 ? -7.001 -4.819 4.253 1.0 96.69 ? 59 ALA A O 1 V9WDR2 UNP 59 A +ATOM 434 N N . ALA A 1 60 ? -8.945 -3.826 4.778 1.0 97.00 ? 60 ALA A N 1 V9WDR2 UNP 60 A +ATOM 435 C CA . ALA A 1 60 ? -9.571 -4.065 3.486 1.0 97.00 ? 60 ALA A CA 1 V9WDR2 UNP 60 A +ATOM 436 C C . ALA A 1 60 ? -9.218 -2.874 2.593 1.0 97.00 ? 60 ALA A C 1 V9WDR2 UNP 60 A +ATOM 437 C CB . ALA A 1 60 ? -11.078 -4.294 3.655 1.0 97.00 ? 60 ALA A CB 1 V9WDR2 UNP 60 A +ATOM 438 O O . ALA A 1 60 ? -8.388 -3.032 1.702 1.0 97.00 ? 60 ALA A O 1 V9WDR2 UNP 60 A +ATOM 439 N N . ASP A 1 61 ? -9.678 -1.682 2.972 1.0 97.75 ? 61 ASP A N 1 V9WDR2 UNP 61 D +ATOM 440 C CA . ASP A 1 61 ? -9.566 -0.491 2.137 1.0 97.75 ? 61 ASP A CA 1 V9WDR2 UNP 61 D +ATOM 441 C C . ASP A 1 61 ? -8.795 0.621 2.858 1.0 97.75 ? 61 ASP A C 1 V9WDR2 UNP 61 D +ATOM 442 C CB . ASP A 1 61 ? -10.970 -0.053 1.683 1.0 97.75 ? 61 ASP A CB 1 V9WDR2 UNP 61 D +ATOM 443 O O . ASP A 1 61 ? -8.899 0.822 4.077 1.0 97.75 ? 61 ASP A O 1 V9WDR2 UNP 61 D +ATOM 444 C CG . ASP A 1 61 ? -11.734 -1.162 0.932 1.0 97.75 ? 61 ASP A CG 1 V9WDR2 UNP 61 D +ATOM 445 O OD1 . ASP A 1 61 ? -11.065 -2.061 0.376 1.0 97.75 ? 61 ASP A OD1 1 V9WDR2 UNP 61 D +ATOM 446 O OD2 . ASP A 1 61 ? -12.985 -1.144 0.950 1.0 97.75 ? 61 ASP A OD2 1 V9WDR2 UNP 61 D +ATOM 447 N N . THR A 1 62 ? -7.955 1.345 2.119 1.0 97.94 ? 62 THR A N 1 V9WDR2 UNP 62 T +ATOM 448 C CA . THR A 1 62 ? -7.251 2.528 2.630 1.0 97.94 ? 62 THR A CA 1 V9WDR2 UNP 62 T +ATOM 449 C C . THR A 1 62 ? -7.199 3.636 1.588 1.0 97.94 ? 62 THR A C 1 V9WDR2 UNP 62 T +ATOM 450 C CB . THR A 1 62 ? -5.844 2.171 3.131 1.0 97.94 ? 62 THR A CB 1 V9WDR2 UNP 62 T +ATOM 451 O O . THR A 1 62 ? -6.617 3.454 0.525 1.0 97.94 ? 62 THR A O 1 V9WDR2 UNP 62 T +ATOM 452 C CG2 . THR A 1 62 ? -5.080 3.375 3.689 1.0 97.94 ? 62 THR A CG2 1 V9WDR2 UNP 62 T +ATOM 453 O OG1 . THR A 1 62 ? -5.959 1.251 4.199 1.0 97.94 ? 62 THR A OG1 1 V9WDR2 UNP 62 T +ATOM 454 N N . GLU A 1 63 ? -7.740 4.810 1.905 1.0 98.44 ? 63 GLU A N 1 V9WDR2 UNP 63 E +ATOM 455 C CA . GLU A 1 63 ? -7.710 5.949 0.977 1.0 98.44 ? 63 GLU A CA 1 V9WDR2 UNP 63 E +ATOM 456 C C . GLU A 1 63 ? -6.307 6.573 0.941 1.0 98.44 ? 63 GLU A C 1 V9WDR2 UNP 63 E +ATOM 457 C CB . GLU A 1 63 ? -8.808 6.955 1.356 1.0 98.44 ? 63 GLU A CB 1 V9WDR2 UNP 63 E +ATOM 458 O O . GLU A 1 63 ? -5.655 6.619 -0.097 1.0 98.44 ? 63 GLU A O 1 V9WDR2 UNP 63 E +ATOM 459 C CG . GLU A 1 63 ? -9.081 7.963 0.232 1.0 98.44 ? 63 GLU A CG 1 V9WDR2 UNP 63 E +ATOM 460 C CD . GLU A 1 63 ? -10.205 8.962 0.566 1.0 98.44 ? 63 GLU A CD 1 V9WDR2 UNP 63 E +ATOM 461 O OE1 . GLU A 1 63 ? -10.260 10.052 -0.054 1.0 98.44 ? 63 GLU A OE1 1 V9WDR2 UNP 63 E +ATOM 462 O OE2 . GLU A 1 63 ? -11.007 8.655 1.475 1.0 98.44 ? 63 GLU A OE2 1 V9WDR2 UNP 63 E +ATOM 463 N N . PHE A 1 64 ? -5.766 6.956 2.100 1.0 98.50 ? 64 PHE A N 1 V9WDR2 UNP 64 F +ATOM 464 C CA . PHE A 1 64 ? -4.447 7.572 2.220 1.0 98.50 ? 64 PHE A CA 1 V9WDR2 UNP 64 F +ATOM 465 C C . PHE A 1 64 ? -3.541 6.834 3.197 1.0 98.50 ? 64 PHE A C 1 V9WDR2 UNP 64 F +ATOM 466 C CB . PHE A 1 64 ? -4.569 9.039 2.624 1.0 98.50 ? 64 PHE A CB 1 V9WDR2 UNP 64 F +ATOM 467 O O . PHE A 1 64 ? -3.806 6.688 4.392 1.0 98.50 ? 64 PHE A O 1 V9WDR2 UNP 64 F +ATOM 468 C CG . PHE A 1 64 ? -5.297 9.893 1.614 1.0 98.50 ? 64 PHE A CG 1 V9WDR2 UNP 64 F +ATOM 469 C CD1 . PHE A 1 64 ? -4.619 10.393 0.487 1.0 98.50 ? 64 PHE A CD1 1 V9WDR2 UNP 64 F +ATOM 470 C CD2 . PHE A 1 64 ? -6.662 10.170 1.791 1.0 98.50 ? 64 PHE A CD2 1 V9WDR2 UNP 64 F +ATOM 471 C CE1 . PHE A 1 64 ? -5.313 11.152 -0.472 1.0 98.50 ? 64 PHE A CE1 1 V9WDR2 UNP 64 F +ATOM 472 C CE2 . PHE A 1 64 ? -7.342 10.959 0.853 1.0 98.50 ? 64 PHE A CE2 1 V9WDR2 UNP 64 F +ATOM 473 C CZ . PHE A 1 64 ? -6.680 11.423 -0.293 1.0 98.50 ? 64 PHE A CZ 1 V9WDR2 UNP 64 F +ATOM 474 N N . ALA A 1 65 ? -2.376 6.461 2.692 1.0 97.81 ? 65 ALA A N 1 V9WDR2 UNP 65 A +ATOM 475 C CA . ALA A 1 65 ? -1.426 5.590 3.343 1.0 97.81 ? 65 ALA A CA 1 V9WDR2 UNP 65 A +ATOM 476 C C . ALA A 1 65 ? -0.027 6.223 3.345 1.0 97.81 ? 65 ALA A C 1 V9WDR2 UNP 65 A +ATOM 477 C CB . ALA A 1 65 ? -1.483 4.271 2.560 1.0 97.81 ? 65 ALA A CB 1 V9WDR2 UNP 65 A +ATOM 478 O O . ALA A 1 65 ? 0.592 6.392 2.300 1.0 97.81 ? 65 ALA A O 1 V9WDR2 UNP 65 A +ATOM 479 N N . SER A 1 66 ? 0.526 6.512 4.525 1.0 98.56 ? 66 SER A N 1 V9WDR2 UNP 66 S +ATOM 480 C CA . SER A 1 66 ? 1.925 6.927 4.687 1.0 98.56 ? 66 SER A CA 1 V9WDR2 UNP 66 S +ATOM 481 C C . SER A 1 66 ? 2.663 5.967 5.612 1.0 98.56 ? 66 SER A C 1 V9WDR2 UNP 66 S +ATOM 482 C CB . SER A 1 66 ? 2.008 8.361 5.212 1.0 98.56 ? 66 SER A CB 1 V9WDR2 UNP 66 S +ATOM 483 O O . SER A 1 66 ? 2.339 5.864 6.792 1.0 98.56 ? 66 SER A O 1 V9WDR2 UNP 66 S +ATOM 484 O OG . SER A 1 66 ? 3.362 8.771 5.335 1.0 98.56 ? 66 SER A OG 1 V9WDR2 UNP 66 S +ATOM 485 N N . GLU A 1 67 ? 3.706 5.319 5.104 1.0 98.00 ? 67 GLU A N 1 V9WDR2 UNP 67 E +ATOM 486 C CA . GLU A 1 67 ? 4.420 4.245 5.797 1.0 98.00 ? 67 GLU A CA 1 V9WDR2 UNP 67 E +ATOM 487 C C . GLU A 1 67 ? 5.928 4.506 5.854 1.0 98.00 ? 67 GLU A C 1 V9WDR2 UNP 67 E +ATOM 488 C CB . GLU A 1 67 ? 4.175 2.920 5.077 1.0 98.00 ? 67 GLU A CB 1 V9WDR2 UNP 67 E +ATOM 489 O O . GLU A 1 67 ? 6.575 4.789 4.844 1.0 98.00 ? 67 GLU A O 1 V9WDR2 UNP 67 E +ATOM 490 C CG . GLU A 1 67 ? 2.723 2.443 5.122 1.0 98.00 ? 67 GLU A CG 1 V9WDR2 UNP 67 E +ATOM 491 C CD . GLU A 1 67 ? 2.557 1.124 4.349 1.0 98.00 ? 67 GLU A CD 1 V9WDR2 UNP 67 E +ATOM 492 O OE1 . GLU A 1 67 ? 1.718 1.086 3.412 1.0 98.00 ? 67 GLU A OE1 1 V9WDR2 UNP 67 E +ATOM 493 O OE2 . GLU A 1 67 ? 3.269 0.169 4.717 1.0 98.00 ? 67 GLU A OE2 1 V9WDR2 UNP 67 E +ATOM 494 N N . ALA A 1 68 ? 6.513 4.357 7.039 1.0 98.38 ? 68 ALA A N 1 V9WDR2 UNP 68 A +ATOM 495 C CA . ALA A 1 68 ? 7.953 4.421 7.255 1.0 98.38 ? 68 ALA A CA 1 V9WDR2 UNP 68 A +ATOM 496 C C . ALA A 1 68 ? 8.426 3.174 8.008 1.0 98.38 ? 68 ALA A C 1 V9WDR2 UNP 68 A +ATOM 497 C CB . ALA A 1 68 ? 8.289 5.722 7.990 1.0 98.38 ? 68 ALA A CB 1 V9WDR2 UNP 68 A +ATOM 498 O O . ALA A 1 68 ? 8.158 3.009 9.202 1.0 98.38 ? 68 ALA A O 1 V9WDR2 UNP 68 A +ATOM 499 N N . GLY A 1 69 ? 9.133 2.276 7.318 1.0 97.75 ? 69 GLY A N 1 V9WDR2 UNP 69 G +ATOM 500 C CA . GLY A 1 69 ? 9.581 1.013 7.912 1.0 97.75 ? 69 GLY A CA 1 V9WDR2 UNP 69 G +ATOM 501 C C . GLY A 1 69 ? 8.445 0.116 8.415 1.0 97.75 ? 69 GLY A C 1 V9WDR2 UNP 69 G +ATOM 502 O O . GLY A 1 69 ? 8.677 -0.679 9.323 1.0 97.75 ? 69 GLY A O 1 V9WDR2 UNP 69 G +ATOM 503 N N . ALA A 1 70 ? 7.227 0.295 7.902 1.0 97.75 ? 70 ALA A N 1 V9WDR2 UNP 70 A +ATOM 504 C CA . ALA A 1 70 ? 6.041 -0.459 8.292 1.0 97.75 ? 70 ALA A CA 1 V9WDR2 UNP 70 A +ATOM 505 C C . ALA A 1 70 ? 5.828 -1.680 7.384 1.0 97.75 ? 70 ALA A C 1 V9WDR2 UNP 70 A +ATOM 506 C CB . ALA A 1 70 ? 4.838 0.493 8.289 1.0 97.75 ? 70 ALA A CB 1 V9WDR2 UNP 70 A +ATOM 507 O O . ALA A 1 70 ? 6.496 -1.823 6.356 1.0 97.75 ? 70 ALA A O 1 V9WDR2 UNP 70 A +ATOM 508 N N . ASN A 1 71 ? 4.918 -2.565 7.795 1.0 98.25 ? 71 ASN A N 1 V9WDR2 UNP 71 N +ATOM 509 C CA . ASN A 1 71 ? 4.402 -3.627 6.943 1.0 98.25 ? 71 ASN A CA 1 V9WDR2 UNP 71 N +ATOM 510 C C . ASN A 1 71 ? 2.884 -3.505 6.822 1.0 98.25 ? 71 ASN A C 1 V9WDR2 UNP 71 N +ATOM 511 C CB . ASN A 1 71 ? 4.788 -5.018 7.464 1.0 98.25 ? 71 ASN A CB 1 V9WDR2 UNP 71 N +ATOM 512 O O . ASN A 1 71 ? 2.185 -3.607 7.832 1.0 98.25 ? 71 ASN A O 1 V9WDR2 UNP 71 N +ATOM 513 C CG . ASN A 1 71 ? 6.275 -5.198 7.676 1.0 98.25 ? 71 ASN A CG 1 V9WDR2 UNP 71 N +ATOM 514 N ND2 . ASN A 1 71 ? 6.692 -5.395 8.903 1.0 98.25 ? 71 ASN A ND2 1 V9WDR2 UNP 71 N +ATOM 515 O OD1 . ASN A 1 71 ? 7.090 -5.200 6.767 1.0 98.25 ? 71 ASN A OD1 1 V9WDR2 UNP 71 N +ATOM 516 N N . ARG A 1 72 ? 2.370 -3.382 5.603 1.0 97.94 ? 72 ARG A N 1 V9WDR2 UNP 72 R +ATOM 517 C CA . ARG A 1 72 ? 0.931 -3.303 5.357 1.0 97.94 ? 72 ARG A CA 1 V9WDR2 UNP 72 R +ATOM 518 C C . ARG A 1 72 ? 0.438 -4.429 4.461 1.0 97.94 ? 72 ARG A C 1 V9WDR2 UNP 72 R +ATOM 519 C CB . ARG A 1 72 ? 0.586 -1.904 4.835 1.0 97.94 ? 72 ARG A CB 1 V9WDR2 UNP 72 R +ATOM 520 O O . ARG A 1 72 ? 1.092 -4.844 3.506 1.0 97.94 ? 72 ARG A O 1 V9WDR2 UNP 72 R +ATOM 521 C CG . ARG A 1 72 ? -0.927 -1.738 4.623 1.0 97.94 ? 72 ARG A CG 1 V9WDR2 UNP 72 R +ATOM 522 C CD . ARG A 1 72 ? -1.304 -0.292 4.324 1.0 97.94 ? 72 ARG A CD 1 V9WDR2 UNP 72 R +ATOM 523 N NE . ARG A 1 72 ? -1.150 0.585 5.505 1.0 97.94 ? 72 ARG A NE 1 V9WDR2 UNP 72 R +ATOM 524 N NH1 . ARG A 1 72 ? -0.317 2.379 4.395 1.0 97.94 ? 72 ARG A NH1 1 V9WDR2 UNP 72 R +ATOM 525 N NH2 . ARG A 1 72 ? -1.013 2.685 6.419 1.0 97.94 ? 72 ARG A NH2 1 V9WDR2 UNP 72 R +ATOM 526 C CZ . ARG A 1 72 ? -0.836 1.861 5.442 1.0 97.94 ? 72 ARG A CZ 1 V9WDR2 UNP 72 R +ATOM 527 N N . THR A 1 73 ? -0.756 -4.913 4.765 1.0 98.50 ? 73 THR A N 1 V9WDR2 UNP 73 T +ATOM 528 C CA . THR A 1 73 ? -1.576 -5.702 3.848 1.0 98.50 ? 73 THR A CA 1 V9WDR2 UNP 73 T +ATOM 529 C C . THR A 1 73 ? -2.913 -4.997 3.669 1.0 98.50 ? 73 THR A C 1 V9WDR2 UNP 73 T +ATOM 530 C CB . THR A 1 73 ? -1.756 -7.138 4.348 1.0 98.50 ? 73 THR A CB 1 V9WDR2 UNP 73 T +ATOM 531 O O . THR A 1 73 ? -3.596 -4.751 4.660 1.0 98.50 ? 73 THR A O 1 V9WDR2 UNP 73 T +ATOM 532 C CG2 . THR A 1 73 ? -2.507 -8.008 3.342 1.0 98.50 ? 73 THR A CG2 1 V9WDR2 UNP 73 T +ATOM 533 O OG1 . THR A 1 73 ? -0.490 -7.733 4.551 1.0 98.50 ? 73 THR A OG1 1 V9WDR2 UNP 73 T +ATOM 534 N N . ALA A 1 74 ? -3.276 -4.681 2.433 1.0 96.81 ? 74 ALA A N 1 V9WDR2 UNP 74 A +ATOM 535 C CA . ALA A 1 74 ? -4.579 -4.132 2.068 1.0 96.81 ? 74 ALA A CA 1 V9WDR2 UNP 74 A +ATOM 536 C C . ALA A 1 74 ? -5.200 -4.976 0.947 1.0 96.81 ? 74 ALA A C 1 V9WDR2 UNP 74 A +ATOM 537 C CB . ALA A 1 74 ? -4.425 -2.652 1.705 1.0 96.81 ? 74 ALA A CB 1 V9WDR2 UNP 74 A +ATOM 538 O O . ALA A 1 74 ? -4.479 -5.708 0.266 1.0 96.81 ? 74 ALA A O 1 V9WDR2 UNP 74 A +ATOM 539 N N . ALA A 1 75 ? -6.518 -4.921 0.775 1.0 97.69 ? 75 ALA A N 1 V9WDR2 UNP 75 A +ATOM 540 C CA . ALA A 1 75 ? -7.109 -5.272 -0.510 1.0 97.69 ? 75 ALA A CA 1 V9WDR2 UNP 75 A +ATOM 541 C C . ALA A 1 75 ? -6.856 -4.098 -1.459 1.0 97.69 ? 75 ALA A C 1 V9WDR2 UNP 75 A +ATOM 542 C CB . ALA A 1 75 ? -8.591 -5.631 -0.346 1.0 97.69 ? 75 ALA A CB 1 V9WDR2 UNP 75 A +ATOM 543 O O . ALA A 1 75 ? -6.045 -4.241 -2.370 1.0 97.69 ? 75 ALA A O 1 V9WDR2 UNP 75 A +ATOM 544 N N . ASP A 1 76 ? -7.386 -2.924 -1.119 1.0 98.12 ? 76 ASP A N 1 V9WDR2 UNP 76 D +ATOM 545 C CA . ASP A 1 76 ? -7.357 -1.758 -1.994 1.0 98.12 ? 76 ASP A CA 1 V9WDR2 UNP 76 D +ATOM 546 C C . ASP A 1 76 ? -6.657 -0.574 -1.315 1.0 98.12 ? 76 ASP A C 1 V9WDR2 UNP 76 D +ATOM 547 C CB . ASP A 1 76 ? -8.790 -1.436 -2.458 1.0 98.12 ? 76 ASP A CB 1 V9WDR2 UNP 76 D +ATOM 548 O O . ASP A 1 76 ? -6.765 -0.341 -0.104 1.0 98.12 ? 76 ASP A O 1 V9WDR2 UNP 76 D +ATOM 549 C CG . ASP A 1 76 ? -9.460 -2.617 -3.191 1.0 98.12 ? 76 ASP A CG 1 V9WDR2 UNP 76 D +ATOM 550 O OD1 . ASP A 1 76 ? -8.718 -3.450 -3.758 1.0 98.12 ? 76 ASP A OD1 1 V9WDR2 UNP 76 D +ATOM 551 O OD2 . ASP A 1 76 ? -10.707 -2.718 -3.166 1.0 98.12 ? 76 ASP A OD2 1 V9WDR2 UNP 76 D +ATOM 552 N N . THR A 1 77 ? -5.868 0.177 -2.084 1.0 98.19 ? 77 THR A N 1 V9WDR2 UNP 77 T +ATOM 553 C CA . THR A 1 77 ? -5.250 1.424 -1.616 1.0 98.19 ? 77 THR A CA 1 V9WDR2 UNP 77 T +ATOM 554 C C . THR A 1 77 ? -5.276 2.496 -2.697 1.0 98.19 ? 77 THR A C 1 V9WDR2 UNP 77 T +ATOM 555 C CB . THR A 1 77 ? -3.820 1.193 -1.105 1.0 98.19 ? 77 THR A CB 1 V9WDR2 UNP 77 T +ATOM 556 O O . THR A 1 77 ? -4.690 2.312 -3.759 1.0 98.19 ? 77 THR A O 1 V9WDR2 UNP 77 T +ATOM 557 C CG2 . THR A 1 77 ? -3.179 2.464 -0.542 1.0 98.19 ? 77 THR A CG2 1 V9WDR2 UNP 77 T +ATOM 558 O OG1 . THR A 1 77 ? -3.843 0.266 -0.038 1.0 98.19 ? 77 THR A OG1 1 V9WDR2 UNP 77 T +ATOM 559 N N . GLU A 1 78 ? -5.895 3.641 -2.418 1.0 98.62 ? 78 GLU A N 1 V9WDR2 UNP 78 E +ATOM 560 C CA . GLU A 1 78 ? -5.974 4.734 -3.397 1.0 98.62 ? 78 GLU A CA 1 V9WDR2 UNP 78 E +ATOM 561 C C . GLU A 1 78 ? -4.633 5.476 -3.488 1.0 98.62 ? 78 GLU A C 1 V9WDR2 UNP 78 E +ATOM 562 C CB . GLU A 1 78 ? -7.155 5.660 -3.059 1.0 98.62 ? 78 GLU A CB 1 V9WDR2 UNP 78 E +ATOM 563 O O . GLU A 1 78 ? -3.992 5.508 -4.535 1.0 98.62 ? 78 GLU A O 1 V9WDR2 UNP 78 E +ATOM 564 C CG . GLU A 1 78 ? -7.537 6.545 -4.253 1.0 98.62 ? 78 GLU A CG 1 V9WDR2 UNP 78 E +ATOM 565 C CD . GLU A 1 78 ? -8.745 7.464 -3.985 1.0 98.62 ? 78 GLU A CD 1 V9WDR2 UNP 78 E +ATOM 566 O OE1 . GLU A 1 78 ? -8.897 8.494 -4.687 1.0 98.62 ? 78 GLU A OE1 1 V9WDR2 UNP 78 E +ATOM 567 O OE2 . GLU A 1 78 ? -9.518 7.155 -3.054 1.0 98.62 ? 78 GLU A OE2 1 V9WDR2 UNP 78 E +ATOM 568 N N . PHE A 1 79 ? -4.124 5.988 -2.365 1.0 98.56 ? 79 PHE A N 1 V9WDR2 UNP 79 F +ATOM 569 C CA . PHE A 1 79 ? -2.868 6.734 -2.313 1.0 98.56 ? 79 PHE A CA 1 V9WDR2 UNP 79 F +ATOM 570 C C . PHE A 1 79 ? -1.903 6.167 -1.286 1.0 98.56 ? 79 PHE A C 1 V9WDR2 UNP 79 F +ATOM 571 C CB . PHE A 1 79 ? -3.138 8.200 -1.985 1.0 98.56 ? 79 PHE A CB 1 V9WDR2 UNP 79 F +ATOM 572 O O . PHE A 1 79 ? -2.141 6.220 -0.081 1.0 98.56 ? 79 PHE A O 1 V9WDR2 UNP 79 F +ATOM 573 C CG . PHE A 1 79 ? -3.946 8.924 -3.030 1.0 98.56 ? 79 PHE A CG 1 V9WDR2 UNP 79 F +ATOM 574 C CD1 . PHE A 1 79 ? -3.320 9.434 -4.182 1.0 98.56 ? 79 PHE A CD1 1 V9WDR2 UNP 79 F +ATOM 575 C CD2 . PHE A 1 79 ? -5.332 9.072 -2.857 1.0 98.56 ? 79 PHE A CD2 1 V9WDR2 UNP 79 F +ATOM 576 C CE1 . PHE A 1 79 ? -4.084 10.079 -5.169 1.0 98.56 ? 79 PHE A CE1 1 V9WDR2 UNP 79 F +ATOM 577 C CE2 . PHE A 1 79 ? -6.086 9.744 -3.829 1.0 98.56 ? 79 PHE A CE2 1 V9WDR2 UNP 79 F +ATOM 578 C CZ . PHE A 1 79 ? -5.472 10.220 -4.997 1.0 98.56 ? 79 PHE A CZ 1 V9WDR2 UNP 79 F +ATOM 579 N N . ALA A 1 80 ? -0.736 5.736 -1.748 1.0 97.94 ? 80 ALA A N 1 V9WDR2 UNP 80 A +ATOM 580 C CA . ALA A 1 80 ? 0.263 5.089 -0.922 1.0 97.94 ? 80 ALA A CA 1 V9WDR2 UNP 80 A +ATOM 581 C C . ALA A 1 80 ? 1.641 5.757 -1.059 1.0 97.94 ? 80 ALA A C 1 V9WDR2 UNP 80 A +ATOM 582 C CB . ALA A 1 80 ? 0.251 3.599 -1.277 1.0 97.94 ? 80 ALA A CB 1 V9WDR2 UNP 80 A +ATOM 583 O O . ALA A 1 80 ? 2.200 5.884 -2.147 1.0 97.94 ? 80 ALA A O 1 V9WDR2 UNP 80 A +ATOM 584 N N . SER A 1 81 ? 2.228 6.158 0.067 1.0 98.62 ? 81 SER A N 1 V9WDR2 UNP 81 S +ATOM 585 C CA . SER A 1 81 ? 3.579 6.711 0.159 1.0 98.62 ? 81 SER A CA 1 V9WDR2 UNP 81 S +ATOM 586 C C . SER A 1 81 ? 4.421 5.892 1.130 1.0 98.62 ? 81 SER A C 1 V9WDR2 UNP 81 S +ATOM 587 C CB . SER A 1 81 ? 3.526 8.180 0.582 1.0 98.62 ? 81 SER A CB 1 V9WDR2 UNP 81 S +ATOM 588 O O . SER A 1 81 ? 4.110 5.813 2.318 1.0 98.62 ? 81 SER A O 1 V9WDR2 UNP 81 S +ATOM 589 O OG . SER A 1 81 ? 4.837 8.698 0.744 1.0 98.62 ? 81 SER A OG 1 V9WDR2 UNP 81 S +ATOM 590 N N . GLU A 1 82 ? 5.537 5.346 0.655 1.0 98.19 ? 82 GLU A N 1 V9WDR2 UNP 82 E +ATOM 591 C CA . GLU A 1 82 ? 6.414 4.471 1.435 1.0 98.19 ? 82 GLU A CA 1 V9WDR2 UNP 82 E +ATOM 592 C C . GLU A 1 82 ? 7.860 4.918 1.471 1.0 98.19 ? 82 GLU A C 1 V9WDR2 UNP 82 E +ATOM 593 C CB . GLU A 1 82 ? 6.435 3.068 0.855 1.0 98.19 ? 82 GLU A CB 1 V9WDR2 UNP 82 E +ATOM 594 O O . GLU A 1 82 ? 8.471 5.233 0.449 1.0 98.19 ? 82 GLU A O 1 V9WDR2 UNP 82 E +ATOM 595 C CG . GLU A 1 82 ? 5.212 2.313 1.311 1.0 98.19 ? 82 GLU A CG 1 V9WDR2 UNP 82 E +ATOM 596 C CD . GLU A 1 82 ? 5.090 0.995 0.552 1.0 98.19 ? 82 GLU A CD 1 V9WDR2 UNP 82 E +ATOM 597 O OE1 . GLU A 1 82 ? 4.484 0.067 1.090 1.0 98.19 ? 82 GLU A OE1 1 V9WDR2 UNP 82 E +ATOM 598 O OE2 . GLU A 1 82 ? 5.472 0.942 -0.628 1.0 98.19 ? 82 GLU A OE2 1 V9WDR2 UNP 82 E +ATOM 599 N N . ALA A 1 83 ? 8.448 4.797 2.656 1.0 98.50 ? 83 ALA A N 1 V9WDR2 UNP 83 A +ATOM 600 C CA . ALA A 1 83 ? 9.882 4.870 2.859 1.0 98.50 ? 83 ALA A CA 1 V9WDR2 UNP 83 A +ATOM 601 C C . ALA A 1 83 ? 10.371 3.630 3.617 1.0 98.50 ? 83 ALA A C 1 V9WDR2 UNP 83 A +ATOM 602 C CB . ALA A 1 83 ? 10.200 6.182 3.579 1.0 98.50 ? 83 ALA A CB 1 V9WDR2 UNP 83 A +ATOM 603 O O . ALA A 1 83 ? 10.107 3.469 4.811 1.0 98.50 ? 83 ALA A O 1 V9WDR2 UNP 83 A +ATOM 604 N N . GLY A 1 84 ? 11.112 2.752 2.936 1.0 98.00 ? 84 GLY A N 1 V9WDR2 UNP 84 G +ATOM 605 C CA . GLY A 1 84 ? 11.689 1.553 3.553 1.0 98.00 ? 84 GLY A CA 1 V9WDR2 UNP 84 G +ATOM 606 C C . GLY A 1 84 ? 10.660 0.569 4.119 1.0 98.00 ? 84 GLY A C 1 V9WDR2 UNP 84 G +ATOM 607 O O . GLY A 1 84 ? 10.976 -0.142 5.069 1.0 98.00 ? 84 GLY A O 1 V9WDR2 UNP 84 G +ATOM 608 N N . ALA A 1 85 ? 9.433 0.583 3.600 1.0 98.06 ? 85 ALA A N 1 V9WDR2 UNP 85 A +ATOM 609 C CA . ALA A 1 85 ? 8.318 -0.239 4.061 1.0 98.06 ? 85 ALA A CA 1 V9WDR2 UNP 85 A +ATOM 610 C C . ALA A 1 85 ? 8.109 -1.467 3.162 1.0 98.06 ? 85 ALA A C 1 V9WDR2 UNP 85 A +ATOM 611 C CB . ALA A 1 85 ? 7.082 0.655 4.102 1.0 98.06 ? 85 ALA A CB 1 V9WDR2 UNP 85 A +ATOM 612 O O . ALA A 1 85 ? 8.720 -1.569 2.093 1.0 98.06 ? 85 ALA A O 1 V9WDR2 UNP 85 A +ATOM 613 N N . ASN A 1 86 ? 7.256 -2.391 3.607 1.0 98.44 ? 86 ASN A N 1 V9WDR2 UNP 86 N +ATOM 614 C CA . ASN A 1 86 ? 6.788 -3.497 2.781 1.0 98.44 ? 86 ASN A CA 1 V9WDR2 UNP 86 N +ATOM 615 C C . ASN A 1 86 ? 5.260 -3.499 2.692 1.0 98.44 ? 86 ASN A C 1 V9WDR2 UNP 86 N +ATOM 616 C CB . ASN A 1 86 ? 7.295 -4.853 3.301 1.0 98.44 ? 86 ASN A CB 1 V9WDR2 UNP 86 N +ATOM 617 O O . ASN A 1 86 ? 4.594 -3.581 3.724 1.0 98.44 ? 86 ASN A O 1 V9WDR2 UNP 86 N +ATOM 618 C CG . ASN A 1 86 ? 8.785 -4.903 3.574 1.0 98.44 ? 86 ASN A CG 1 V9WDR2 UNP 86 N +ATOM 619 N ND2 . ASN A 1 86 ? 9.163 -5.049 4.821 1.0 98.44 ? 86 ASN A ND2 1 V9WDR2 UNP 86 N +ATOM 620 O OD1 . ASN A 1 86 ? 9.638 -4.847 2.699 1.0 98.44 ? 86 ASN A OD1 1 V9WDR2 UNP 86 N +ATOM 621 N N . ARG A 1 87 ? 4.708 -3.537 1.479 1.0 98.12 ? 87 ARG A N 1 V9WDR2 UNP 87 R +ATOM 622 C CA . ARG A 1 87 ? 3.258 -3.640 1.279 1.0 98.12 ? 87 ARG A CA 1 V9WDR2 UNP 87 R +ATOM 623 C C . ARG A 1 87 ? 2.877 -4.805 0.393 1.0 98.12 ? 87 ARG A C 1 V9WDR2 UNP 87 R +ATOM 624 C CB . ARG A 1 87 ? 2.692 -2.309 0.777 1.0 98.12 ? 87 ARG A CB 1 V9WDR2 UNP 87 R +ATOM 625 O O . ARG A 1 87 ? 3.547 -5.130 -0.585 1.0 98.12 ? 87 ARG A O 1 V9WDR2 UNP 87 R +ATOM 626 C CG . ARG A 1 87 ? 1.167 -2.267 0.571 1.0 98.12 ? 87 ARG A CG 1 V9WDR2 UNP 87 R +ATOM 627 C CD . ARG A 1 87 ? 0.679 -1.031 -0.189 1.0 98.12 ? 87 ARG A CD 1 V9WDR2 UNP 87 R +ATOM 628 N NE . ARG A 1 87 ? 1.335 0.201 0.257 1.0 98.12 ? 87 ARG A NE 1 V9WDR2 UNP 87 R +ATOM 629 N NH1 . ARG A 1 87 ? 2.842 0.450 -1.489 1.0 98.12 ? 87 ARG A NH1 1 V9WDR2 UNP 87 R +ATOM 630 N NH2 . ARG A 1 87 ? 2.568 2.042 0.004 1.0 98.12 ? 87 ARG A NH2 1 V9WDR2 UNP 87 R +ATOM 631 C CZ . ARG A 1 87 ? 2.239 0.872 -0.418 1.0 98.12 ? 87 ARG A CZ 1 V9WDR2 UNP 87 R +ATOM 632 N N . THR A 1 88 ? 1.749 -5.407 0.736 1.0 98.50 ? 88 THR A N 1 V9WDR2 UNP 88 T +ATOM 633 C CA . THR A 1 88 ? 0.972 -6.259 -0.157 1.0 98.50 ? 88 THR A CA 1 V9WDR2 UNP 88 T +ATOM 634 C C . THR A 1 88 ? -0.411 -5.645 -0.355 1.0 98.50 ? 88 THR A C 1 V9WDR2 UNP 88 T +ATOM 635 C CB . THR A 1 88 ? 0.894 -7.684 0.391 1.0 98.50 ? 88 THR A CB 1 V9WDR2 UNP 88 T +ATOM 636 O O . THR A 1 88 ? -1.085 -5.369 0.634 1.0 98.50 ? 88 THR A O 1 V9WDR2 UNP 88 T +ATOM 637 C CG2 . THR A 1 88 ? 0.203 -8.637 -0.579 1.0 98.50 ? 88 THR A CG2 1 V9WDR2 UNP 88 T +ATOM 638 O OG1 . THR A 1 88 ? 2.206 -8.170 0.592 1.0 98.50 ? 88 THR A OG1 1 V9WDR2 UNP 88 T +ATOM 639 N N . ALA A 1 89 ? -0.817 -5.436 -1.602 1.0 97.12 ? 89 ALA A N 1 V9WDR2 UNP 89 A +ATOM 640 C CA . ALA A 1 89 ? -2.160 -5.009 -1.982 1.0 97.12 ? 89 ALA A CA 1 V9WDR2 UNP 89 A +ATOM 641 C C . ALA A 1 89 ? -2.717 -5.941 -3.070 1.0 97.12 ? 89 ALA A C 1 V9WDR2 UNP 89 A +ATOM 642 C CB . ALA A 1 89 ? -2.135 -3.538 -2.405 1.0 97.12 ? 89 ALA A CB 1 V9WDR2 UNP 89 A +ATOM 643 O O . ALA A 1 89 ? -1.945 -6.645 -3.726 1.0 97.12 ? 89 ALA A O 1 V9WDR2 UNP 89 A +ATOM 644 N N . ALA A 1 90 ? -4.034 -5.982 -3.250 1.0 97.75 ? 90 ALA A N 1 V9WDR2 UNP 90 A +ATOM 645 C CA . ALA A 1 90 ? -4.599 -6.429 -4.517 1.0 97.75 ? 90 ALA A CA 1 V9WDR2 UNP 90 A +ATOM 646 C C . ALA A 1 90 ? -4.451 -5.282 -5.519 1.0 97.75 ? 90 ALA A C 1 V9WDR2 UNP 90 A +ATOM 647 C CB . ALA A 1 90 ? -6.047 -6.900 -4.329 1.0 97.75 ? 90 ALA A CB 1 V9WDR2 UNP 90 A +ATOM 648 O O . ALA A 1 90 ? -3.647 -5.404 -6.442 1.0 97.75 ? 90 ALA A O 1 V9WDR2 UNP 90 A +ATOM 649 N N . ASP A 1 91 ? -5.070 -4.140 -5.224 1.0 98.25 ? 91 ASP A N 1 V9WDR2 UNP 91 D +ATOM 650 C CA . ASP A 1 91 ? -5.121 -3.003 -6.135 1.0 98.25 ? 91 ASP A CA 1 V9WDR2 UNP 91 D +ATOM 651 C C . ASP A 1 91 ? -4.493 -1.754 -5.505 1.0 98.25 ? 91 ASP A C 1 V9WDR2 UNP 91 D +ATOM 652 C CB . ASP A 1 91 ? -6.571 -2.790 -6.608 1.0 98.25 ? 91 ASP A CB 1 V9WDR2 UNP 91 D +ATOM 653 O O . ASP A 1 91 ? -4.578 -1.499 -4.297 1.0 98.25 ? 91 ASP A O 1 V9WDR2 UNP 91 D +ATOM 654 C CG . ASP A 1 91 ? -7.144 -4.025 -7.334 1.0 98.25 ? 91 ASP A CG 1 V9WDR2 UNP 91 D +ATOM 655 O OD1 . ASP A 1 91 ? -6.336 -4.790 -7.907 1.0 98.25 ? 91 ASP A OD1 1 V9WDR2 UNP 91 D +ATOM 656 O OD2 . ASP A 1 91 ? -8.380 -4.224 -7.321 1.0 98.25 ? 91 ASP A OD2 1 V9WDR2 UNP 91 D +ATOM 657 N N . THR A 1 92 ? -3.786 -0.969 -6.318 1.0 98.06 ? 92 THR A N 1 V9WDR2 UNP 92 T +ATOM 658 C CA . THR A 1 92 ? -3.234 0.324 -5.900 1.0 98.06 ? 92 THR A CA 1 V9WDR2 UNP 92 T +ATOM 659 C C . THR A 1 92 ? -3.361 1.361 -7.007 1.0 98.06 ? 92 THR A C 1 V9WDR2 UNP 92 T +ATOM 660 C CB . THR A 1 92 ? -1.778 0.191 -5.434 1.0 98.06 ? 92 THR A CB 1 V9WDR2 UNP 92 T +ATOM 661 O O . THR A 1 92 ? -2.806 1.180 -8.088 1.0 98.06 ? 92 THR A O 1 V9WDR2 UNP 92 T +ATOM 662 C CG2 . THR A 1 92 ? -1.191 1.512 -4.930 1.0 98.06 ? 92 THR A CG2 1 V9WDR2 UNP 92 T +ATOM 663 O OG1 . THR A 1 92 ? -1.717 -0.708 -4.346 1.0 98.06 ? 92 THR A OG1 1 V9WDR2 UNP 92 T +ATOM 664 N N . GLU A 1 93 ? -4.039 2.475 -6.740 1.0 98.56 ? 93 GLU A N 1 V9WDR2 UNP 93 E +ATOM 665 C CA . GLU A 1 93 ? -4.202 3.530 -7.750 1.0 98.56 ? 93 GLU A CA 1 V9WDR2 UNP 93 E +ATOM 666 C C . GLU A 1 93 ? -2.918 4.361 -7.878 1.0 98.56 ? 93 GLU A C 1 V9WDR2 UNP 93 E +ATOM 667 C CB . GLU A 1 93 ? -5.443 4.381 -7.440 1.0 98.56 ? 93 GLU A CB 1 V9WDR2 UNP 93 E +ATOM 668 O O . GLU A 1 93 ? -2.315 4.438 -8.946 1.0 98.56 ? 93 GLU A O 1 V9WDR2 UNP 93 E +ATOM 669 C CG . GLU A 1 93 ? -5.877 5.198 -8.666 1.0 98.56 ? 93 GLU A CG 1 V9WDR2 UNP 93 E +ATOM 670 C CD . GLU A 1 93 ? -7.136 6.054 -8.425 1.0 98.56 ? 93 GLU A CD 1 V9WDR2 UNP 93 E +ATOM 671 O OE1 . GLU A 1 93 ? -7.345 7.046 -9.166 1.0 98.56 ? 93 GLU A OE1 1 V9WDR2 UNP 93 E +ATOM 672 O OE2 . GLU A 1 93 ? -7.894 5.725 -7.489 1.0 98.56 ? 93 GLU A OE2 1 V9WDR2 UNP 93 E +ATOM 673 N N . PHE A 1 94 ? -2.410 4.902 -6.768 1.0 98.56 ? 94 PHE A N 1 V9WDR2 UNP 94 F +ATOM 674 C CA . PHE A 1 94 ? -1.196 5.714 -6.742 1.0 98.56 ? 94 PHE A CA 1 V9WDR2 UNP 94 F +ATOM 675 C C . PHE A 1 94 ? -0.197 5.221 -5.696 1.0 98.56 ? 94 PHE A C 1 V9WDR2 UNP 94 F +ATOM 676 C CB . PHE A 1 94 ? -1.555 7.181 -6.482 1.0 98.56 ? 94 PHE A CB 1 V9WDR2 UNP 94 F +ATOM 677 O O . PHE A 1 94 ? -0.442 5.283 -4.492 1.0 98.56 ? 94 PHE A O 1 V9WDR2 UNP 94 F +ATOM 678 C CG . PHE A 1 94 ? -2.416 7.817 -7.550 1.0 98.56 ? 94 PHE A CG 1 V9WDR2 UNP 94 F +ATOM 679 C CD1 . PHE A 1 94 ? -1.829 8.353 -8.712 1.0 98.56 ? 94 PHE A CD1 1 V9WDR2 UNP 94 F +ATOM 680 C CD2 . PHE A 1 94 ? -3.810 7.872 -7.384 1.0 98.56 ? 94 PHE A CD2 1 V9WDR2 UNP 94 F +ATOM 681 C CE1 . PHE A 1 94 ? -2.636 8.913 -9.719 1.0 98.56 ? 94 PHE A CE1 1 V9WDR2 UNP 94 F +ATOM 682 C CE2 . PHE A 1 94 ? -4.609 8.468 -8.371 1.0 98.56 ? 94 PHE A CE2 1 V9WDR2 UNP 94 F +ATOM 683 C CZ . PHE A 1 94 ? -4.031 8.958 -9.551 1.0 98.56 ? 94 PHE A CZ 1 V9WDR2 UNP 94 F +ATOM 684 N N . ALA A 1 95 ? 0.999 4.841 -6.145 1.0 97.81 ? 95 ALA A N 1 V9WDR2 UNP 95 A +ATOM 685 C CA . ALA A 1 95 ? 2.110 4.442 -5.289 1.0 97.81 ? 95 ALA A CA 1 V9WDR2 UNP 95 A +ATOM 686 C C . ALA A 1 95 ? 3.343 5.333 -5.493 1.0 97.81 ? 95 ALA A C 1 V9WDR2 UNP 95 A +ATOM 687 C CB . ALA A 1 95 ? 2.431 2.967 -5.538 1.0 97.81 ? 95 ALA A CB 1 V9WDR2 UNP 95 A +ATOM 688 O O . ALA A 1 95 ? 3.851 5.502 -6.603 1.0 97.81 ? 95 ALA A O 1 V9WDR2 UNP 95 A +ATOM 689 N N . SER A 1 96 ? 3.884 5.856 -4.393 1.0 98.56 ? 96 SER A N 1 V9WDR2 UNP 96 S +ATOM 690 C CA . SER A 1 96 ? 5.182 6.526 -4.336 1.0 98.56 ? 96 SER A CA 1 V9WDR2 UNP 96 S +ATOM 691 C C . SER A 1 96 ? 6.097 5.808 -3.349 1.0 98.56 ? 96 SER A C 1 V9WDR2 UNP 96 S +ATOM 692 C CB . SER A 1 96 ? 5.008 7.998 -3.967 1.0 98.56 ? 96 SER A CB 1 V9WDR2 UNP 96 S +ATOM 693 O O . SER A 1 96 ? 5.865 5.819 -2.142 1.0 98.56 ? 96 SER A O 1 V9WDR2 UNP 96 S +ATOM 694 O OG . SER A 1 96 ? 6.278 8.613 -3.816 1.0 98.56 ? 96 SER A OG 1 V9WDR2 UNP 96 S +ATOM 695 N N . GLU A 1 97 ? 7.181 5.229 -3.849 1.0 98.25 ? 97 GLU A N 1 V9WDR2 UNP 97 E +ATOM 696 C CA . GLU A 1 97 ? 7.997 4.272 -3.108 1.0 98.25 ? 97 GLU A CA 1 V9WDR2 UNP 97 E +ATOM 697 C C . GLU A 1 97 ? 9.470 4.681 -3.081 1.0 98.25 ? 97 GLU A C 1 V9WDR2 UNP 97 E +ATOM 698 C CB . GLU A 1 97 ? 7.858 2.892 -3.752 1.0 98.25 ? 97 GLU A CB 1 V9WDR2 UNP 97 E +ATOM 699 O O . GLU A 1 97 ? 10.115 4.849 -4.118 1.0 98.25 ? 97 GLU A O 1 V9WDR2 UNP 97 E +ATOM 700 C CG . GLU A 1 97 ? 6.424 2.354 -3.693 1.0 98.25 ? 97 GLU A CG 1 V9WDR2 UNP 97 E +ATOM 701 C CD . GLU A 1 97 ? 6.317 1.008 -4.409 1.0 98.25 ? 97 GLU A CD 1 V9WDR2 UNP 97 E +ATOM 702 O OE1 . GLU A 1 97 ? 5.309 0.795 -5.119 1.0 98.25 ? 97 GLU A OE1 1 V9WDR2 UNP 97 E +ATOM 703 O OE2 . GLU A 1 97 ? 7.260 0.195 -4.317 1.0 98.25 ? 97 GLU A OE2 1 V9WDR2 UNP 97 E +ATOM 704 N N . ALA A 1 98 ? 10.041 4.792 -1.882 1.0 98.44 ? 98 ALA A N 1 V9WDR2 UNP 98 A +ATOM 705 C CA . ALA A 1 98 ? 11.459 5.057 -1.676 1.0 98.44 ? 98 ALA A CA 1 V9WDR2 UNP 98 A +ATOM 706 C C . ALA A 1 98 ? 12.101 3.930 -0.859 1.0 98.44 ? 98 ALA A C 1 V9WDR2 UNP 98 A +ATOM 707 C CB . ALA A 1 98 ? 11.616 6.434 -1.024 1.0 98.44 ? 98 ALA A CB 1 V9WDR2 UNP 98 A +ATOM 708 O O . ALA A 1 98 ? 11.889 3.816 0.350 1.0 98.44 ? 98 ALA A O 1 V9WDR2 UNP 98 A +ATOM 709 N N . GLY A 1 99 ? 12.911 3.092 -1.509 1.0 97.88 ? 99 GLY A N 1 V9WDR2 UNP 99 G +ATOM 710 C CA . GLY A 1 99 ? 13.550 1.951 -0.844 1.0 97.88 ? 99 GLY A CA 1 V9WDR2 UNP 99 G +ATOM 711 C C . GLY A 1 99 ? 12.567 0.922 -0.276 1.0 97.88 ? 99 GLY A C 1 V9WDR2 UNP 99 G +ATOM 712 O O . GLY A 1 99 ? 12.921 0.226 0.673 1.0 97.88 ? 99 GLY A O 1 V9WDR2 UNP 99 G +ATOM 713 N N . ALA A 1 100 ? 11.340 0.879 -0.796 1.0 98.12 ? 100 ALA A N 1 V9WDR2 UNP 100 A +ATOM 714 C CA . ALA A 1 100 ? 10.280 -0.014 -0.341 1.0 98.12 ? 100 ALA A CA 1 V9WDR2 UNP 100 A +ATOM 715 C C . ALA A 1 100 ? 10.281 -1.340 -1.115 1.0 98.12 ? 100 ALA A C 1 V9WDR2 UNP 100 A +ATOM 716 C CB . ALA A 1 100 ? 8.944 0.725 -0.466 1.0 98.12 ? 100 ALA A CB 1 V9WDR2 UNP 100 A +ATOM 717 O O . ALA A 1 100 ? 10.928 -1.452 -2.162 1.0 98.12 ? 100 ALA A O 1 V9WDR2 UNP 100 A +ATOM 718 N N . ASN A 1 101 ? 9.562 -2.335 -0.591 1.0 98.44 ? 101 ASN A N 1 V9WDR2 UNP 101 N +ATOM 719 C CA . ASN A 1 101 ? 9.231 -3.548 -1.333 1.0 98.44 ? 101 ASN A CA 1 V9WDR2 UNP 101 N +ATOM 720 C C . ASN A 1 101 ? 7.718 -3.720 -1.420 1.0 98.44 ? 101 ASN A C 1 V9WDR2 UNP 101 N +ATOM 721 C CB . ASN A 1 101 ? 9.875 -4.800 -0.730 1.0 98.44 ? 101 ASN A CB 1 V9WDR2 UNP 101 N +ATOM 722 O O . ASN A 1 101 ? 7.051 -3.906 -0.403 1.0 98.44 ? 101 ASN A O 1 V9WDR2 UNP 101 N +ATOM 723 C CG . ASN A 1 101 ? 11.365 -4.670 -0.524 1.0 98.44 ? 101 ASN A CG 1 V9WDR2 UNP 101 N +ATOM 724 N ND2 . ASN A 1 101 ? 11.791 -4.664 0.716 1.0 98.44 ? 101 ASN A ND2 1 V9WDR2 UNP 101 N +ATOM 725 O OD1 . ASN A 1 101 ? 12.167 -4.597 -1.445 1.0 98.44 ? 101 ASN A OD1 1 V9WDR2 UNP 101 N +ATOM 726 N N . THR A 1 102 ? 7.187 -3.729 -2.632 1.0 97.62 ? 102 THR A N 1 V9WDR2 UNP 102 T +ATOM 727 C CA . THR A 1 102 ? 5.747 -3.793 -2.861 1.0 97.62 ? 102 THR A CA 1 V9WDR2 UNP 102 T +ATOM 728 C C . THR A 1 102 ? 5.364 -5.002 -3.687 1.0 97.62 ? 102 THR A C 1 V9WDR2 UNP 102 T +ATOM 729 C CB . THR A 1 102 ? 5.226 -2.497 -3.479 1.0 97.62 ? 102 THR A CB 1 V9WDR2 UNP 102 T +ATOM 730 O O . THR A 1 102 ? 6.095 -5.485 -4.557 1.0 97.62 ? 102 THR A O 1 V9WDR2 UNP 102 T +ATOM 731 C CG2 . THR A 1 102 ? 5.369 -1.375 -2.465 1.0 97.62 ? 102 THR A CG2 1 V9WDR2 UNP 102 T +ATOM 732 O OG1 . THR A 1 102 ? 5.967 -2.188 -4.628 1.0 97.62 ? 102 THR A OG1 1 V9WDR2 UNP 102 T +ATOM 733 N N . THR A 1 103 ? 4.204 -5.554 -3.365 1.0 98.12 ? 103 THR A N 1 V9WDR2 UNP 103 T +ATOM 734 C CA . THR A 1 103 ? 3.535 -6.567 -4.169 1.0 98.12 ? 103 THR A CA 1 V9WDR2 UNP 103 T +ATOM 735 C C . THR A 1 103 ? 2.092 -6.142 -4.362 1.0 98.12 ? 103 THR A C 1 V9WDR2 UNP 103 T +ATOM 736 C CB . THR A 1 103 ? 3.650 -7.954 -3.534 1.0 98.12 ? 103 THR A CB 1 V9WDR2 UNP 103 T +ATOM 737 O O . THR A 1 103 ? 1.389 -5.947 -3.375 1.0 98.12 ? 103 THR A O 1 V9WDR2 UNP 103 T +ATOM 738 C CG2 . THR A 1 103 ? 3.000 -9.041 -4.388 1.0 98.12 ? 103 THR A CG2 1 V9WDR2 UNP 103 T +ATOM 739 O OG1 . THR A 1 103 ? 5.021 -8.277 -3.422 1.0 98.12 ? 103 THR A OG1 1 V9WDR2 UNP 103 T +ATOM 740 N N . ALA A 1 104 ? 1.671 -6.004 -5.611 1.0 96.81 ? 104 ALA A N 1 V9WDR2 UNP 104 A +ATOM 741 C CA . ALA A 1 104 ? 0.291 -5.740 -5.996 1.0 96.81 ? 104 ALA A CA 1 V9WDR2 UNP 104 A +ATOM 742 C C . ALA A 1 104 ? -0.157 -6.770 -7.042 1.0 96.81 ? 104 ALA A C 1 V9WDR2 UNP 104 A +ATOM 743 C CB . ALA A 1 104 ? 0.165 -4.290 -6.470 1.0 96.81 ? 104 ALA A CB 1 V9WDR2 UNP 104 A +ATOM 744 O O . ALA A 1 104 ? 0.686 -7.406 -7.678 1.0 96.81 ? 104 ALA A O 1 V9WDR2 UNP 104 A +ATOM 745 N N . ALA A 1 105 ? -1.460 -6.972 -7.213 1.0 97.00 ? 105 ALA A N 1 V9WDR2 UNP 105 A +ATOM 746 C CA . ALA A 1 105 ? -1.960 -7.533 -8.462 1.0 97.00 ? 105 ALA A CA 1 V9WDR2 UNP 105 A +ATOM 747 C C . ALA A 1 105 ? -1.900 -6.428 -9.520 1.0 97.00 ? 105 ALA A C 1 V9WDR2 UNP 105 A +ATOM 748 C CB . ALA A 1 105 ? -3.362 -8.123 -8.269 1.0 97.00 ? 105 ALA A CB 1 V9WDR2 UNP 105 A +ATOM 749 O O . ALA A 1 105 ? -1.099 -6.539 -10.448 1.0 97.00 ? 105 ALA A O 1 V9WDR2 UNP 105 A +ATOM 750 N N . ASP A 1 106 ? -2.596 -5.320 -9.272 1.0 97.88 ? 106 ASP A N 1 V9WDR2 UNP 106 D +ATOM 751 C CA . ASP A 1 106 ? -2.724 -4.225 -10.226 1.0 97.88 ? 106 ASP A CA 1 V9WDR2 UNP 106 D +ATOM 752 C C . ASP A 1 106 ? -2.212 -2.904 -9.636 1.0 97.88 ? 106 ASP A C 1 V9WDR2 UNP 106 D +ATOM 753 C CB . ASP A 1 106 ? -4.177 -4.154 -10.733 1.0 97.88 ? 106 ASP A CB 1 V9WDR2 UNP 106 D +ATOM 754 O O . ASP A 1 106 ? -2.334 -2.612 -8.441 1.0 97.88 ? 106 ASP A O 1 V9WDR2 UNP 106 D +ATOM 755 C CG . ASP A 1 106 ? -4.621 -5.458 -11.428 1.0 97.88 ? 106 ASP A CG 1 V9WDR2 UNP 106 D +ATOM 756 O OD1 . ASP A 1 106 ? -3.736 -6.153 -11.979 1.0 97.88 ? 106 ASP A OD1 1 V9WDR2 UNP 106 D +ATOM 757 O OD2 . ASP A 1 106 ? -5.831 -5.775 -11.429 1.0 97.88 ? 106 ASP A OD2 1 V9WDR2 UNP 106 D +ATOM 758 N N . THR A 1 107 ? -1.564 -2.094 -10.472 1.0 97.62 ? 107 THR A N 1 V9WDR2 UNP 107 T +ATOM 759 C CA . THR A 1 107 ? -1.125 -0.746 -10.094 1.0 97.62 ? 107 THR A CA 1 V9WDR2 UNP 107 T +ATOM 760 C C . THR A 1 107 ? -1.329 0.233 -11.239 1.0 97.62 ? 107 THR A C 1 V9WDR2 UNP 107 T +ATOM 761 C CB . THR A 1 107 ? 0.335 -0.729 -9.618 1.0 97.62 ? 107 THR A CB 1 V9WDR2 UNP 107 T +ATOM 762 O O . THR A 1 107 ? -0.743 0.059 -12.308 1.0 97.62 ? 107 THR A O 1 V9WDR2 UNP 107 T +ATOM 763 C CG2 . THR A 1 107 ? 0.778 0.646 -9.115 1.0 97.62 ? 107 THR A CG2 1 V9WDR2 UNP 107 T +ATOM 764 O OG1 . THR A 1 107 ? 0.504 -1.622 -8.540 1.0 97.62 ? 107 THR A OG1 1 V9WDR2 UNP 107 T +ATOM 765 N N . GLU A 1 108 ? -2.106 1.292 -11.023 1.0 98.44 ? 108 GLU A N 1 V9WDR2 UNP 108 E +ATOM 766 C CA . GLU A 1 108 ? -2.356 2.283 -12.076 1.0 98.44 ? 108 GLU A CA 1 V9WDR2 UNP 108 E +ATOM 767 C C . GLU A 1 108 ? -1.146 3.211 -12.244 1.0 98.44 ? 108 GLU A C 1 V9WDR2 UNP 108 E +ATOM 768 C CB . GLU A 1 108 ? -3.666 3.039 -11.805 1.0 98.44 ? 108 GLU A CB 1 V9WDR2 UNP 108 E +ATOM 769 O O . GLU A 1 108 ? -0.526 3.259 -13.307 1.0 98.44 ? 108 GLU A O 1 V9WDR2 UNP 108 E +ATOM 770 C CG . GLU A 1 108 ? -4.144 3.770 -13.069 1.0 98.44 ? 108 GLU A CG 1 V9WDR2 UNP 108 E +ATOM 771 C CD . GLU A 1 108 ? -5.473 4.524 -12.882 1.0 98.44 ? 108 GLU A CD 1 V9WDR2 UNP 108 E +ATOM 772 O OE1 . GLU A 1 108 ? -5.759 5.443 -13.690 1.0 98.44 ? 108 GLU A OE1 1 V9WDR2 UNP 108 E +ATOM 773 O OE2 . GLU A 1 108 ? -6.208 4.187 -11.932 1.0 98.44 ? 108 GLU A OE2 1 V9WDR2 UNP 108 E +ATOM 774 N N . PHE A 1 109 ? -0.717 3.873 -11.169 1.0 98.31 ? 109 PHE A N 1 V9WDR2 UNP 109 F +ATOM 775 C CA . PHE A 1 109 ? 0.409 4.801 -11.179 1.0 98.31 ? 109 PHE A CA 1 V9WDR2 UNP 109 F +ATOM 776 C C . PHE A 1 109 ? 1.453 4.461 -10.126 1.0 98.31 ? 109 PHE A C 1 V9WDR2 UNP 109 F +ATOM 777 C CB . PHE A 1 109 ? -0.080 6.233 -10.977 1.0 98.31 ? 109 PHE A CB 1 V9WDR2 UNP 109 F +ATOM 778 O O . PHE A 1 109 ? 1.201 4.432 -8.924 1.0 98.31 ? 109 PHE A O 1 V9WDR2 UNP 109 F +ATOM 779 C CG . PHE A 1 109 ? -0.970 6.740 -12.085 1.0 98.31 ? 109 PHE A CG 1 V9WDR2 UNP 109 F +ATOM 780 C CD1 . PHE A 1 109 ? -0.409 7.251 -13.271 1.0 98.31 ? 109 PHE A CD1 1 V9WDR2 UNP 109 F +ATOM 781 C CD2 . PHE A 1 109 ? -2.365 6.691 -11.934 1.0 98.31 ? 109 PHE A CD2 1 V9WDR2 UNP 109 F +ATOM 782 C CE1 . PHE A 1 109 ? -1.244 7.692 -14.313 1.0 98.31 ? 109 PHE A CE1 1 V9WDR2 UNP 109 F +ATOM 783 C CE2 . PHE A 1 109 ? -3.194 7.165 -12.959 1.0 98.31 ? 109 PHE A CE2 1 V9WDR2 UNP 109 F +ATOM 784 C CZ . PHE A 1 109 ? -2.640 7.636 -14.159 1.0 98.31 ? 109 PHE A CZ 1 V9WDR2 UNP 109 F +ATOM 785 N N . ALA A 1 110 ? 2.689 4.320 -10.584 1.0 97.31 ? 110 ALA A N 1 V9WDR2 UNP 110 A +ATOM 786 C CA . ALA A 1 110 ? 3.825 3.962 -9.760 1.0 97.31 ? 110 ALA A CA 1 V9WDR2 UNP 110 A +ATOM 787 C C . ALA A 1 110 ? 5.004 4.920 -9.963 1.0 97.31 ? 110 ALA A C 1 V9WDR2 UNP 110 A +ATOM 788 C CB . ALA A 1 110 ? 4.199 2.529 -10.124 1.0 97.31 ? 110 ALA A CB 1 V9WDR2 UNP 110 A +ATOM 789 O O . ALA A 1 110 ? 5.500 5.102 -11.076 1.0 97.31 ? 110 ALA A O 1 V9WDR2 UNP 110 A +ATOM 790 N N . SER A 1 111 ? 5.528 5.466 -8.866 1.0 98.31 ? 111 SER A N 1 V9WDR2 UNP 111 S +ATOM 791 C CA . SER A 1 111 ? 6.783 6.217 -8.831 1.0 98.31 ? 111 SER A CA 1 V9WDR2 UNP 111 S +ATOM 792 C C . SER A 1 111 ? 7.756 5.579 -7.846 1.0 98.31 ? 111 SER A C 1 V9WDR2 UNP 111 S +ATOM 793 C CB . SER A 1 111 ? 6.517 7.682 -8.484 1.0 98.31 ? 111 SER A CB 1 V9WDR2 UNP 111 S +ATOM 794 O O . SER A 1 111 ? 7.487 5.525 -6.651 1.0 98.31 ? 111 SER A O 1 V9WDR2 UNP 111 S +ATOM 795 O OG . SER A 1 111 ? 7.742 8.388 -8.368 1.0 98.31 ? 111 SER A OG 1 V9WDR2 UNP 111 S +ATOM 796 N N . GLU A 1 112 ? 8.921 5.141 -8.321 1.0 97.62 ? 112 GLU A N 1 V9WDR2 UNP 112 E +ATOM 797 C CA . GLU A 1 112 ? 9.907 4.420 -7.511 1.0 97.62 ? 112 GLU A CA 1 V9WDR2 UNP 112 E +ATOM 798 C C . GLU A 1 112 ? 11.277 5.079 -7.489 1.0 97.62 ? 112 GLU A C 1 V9WDR2 UNP 112 E +ATOM 799 C CB . GLU A 1 112 ? 10.133 3.010 -8.037 1.0 97.62 ? 112 GLU A CB 1 V9WDR2 UNP 112 E +ATOM 800 O O . GLU A 1 112 ? 11.841 5.443 -8.524 1.0 97.62 ? 112 GLU A O 1 V9WDR2 UNP 112 E +ATOM 801 C CG . GLU A 1 112 ? 8.877 2.167 -7.996 1.0 97.62 ? 112 GLU A CG 1 V9WDR2 UNP 112 E +ATOM 802 C CD . GLU A 1 112 ? 9.197 0.721 -8.363 1.0 97.62 ? 112 GLU A CD 1 V9WDR2 UNP 112 E +ATOM 803 O OE1 . GLU A 1 112 ? 8.546 -0.175 -7.824 1.0 97.62 ? 112 GLU A OE1 1 V9WDR2 UNP 112 E +ATOM 804 O OE2 . GLU A 1 112 ? 10.059 0.488 -9.224 1.0 97.62 ? 112 GLU A OE2 1 V9WDR2 UNP 112 E +ATOM 805 N N . ALA A 1 113 ? 11.885 5.107 -6.307 1.0 98.06 ? 113 ALA A N 1 V9WDR2 UNP 113 A +ATOM 806 C CA . ALA A 1 113 ? 13.285 5.440 -6.117 1.0 98.06 ? 113 ALA A CA 1 V9WDR2 UNP 113 A +ATOM 807 C C . ALA A 1 113 ? 13.973 4.371 -5.261 1.0 98.06 ? 113 ALA A C 1 V9WDR2 UNP 113 A +ATOM 808 C CB . ALA A 1 113 ? 13.379 6.843 -5.512 1.0 98.06 ? 113 ALA A CB 1 V9WDR2 UNP 113 A +ATOM 809 O O . ALA A 1 113 ? 13.775 4.297 -4.047 1.0 98.06 ? 113 ALA A O 1 V9WDR2 UNP 113 A +ATOM 810 N N . GLY A 1 114 ? 14.820 3.544 -5.878 1.0 97.62 ? 114 GLY A N 1 V9WDR2 UNP 114 G +ATOM 811 C CA . GLY A 1 114 ? 15.536 2.491 -5.150 1.0 97.62 ? 114 GLY A CA 1 V9WDR2 UNP 114 G +ATOM 812 C C . GLY A 1 114 ? 14.639 1.390 -4.574 1.0 97.62 ? 114 GLY A C 1 V9WDR2 UNP 114 G +ATOM 813 O O . GLY A 1 114 ? 15.062 0.736 -3.625 1.0 97.62 ? 114 GLY A O 1 V9WDR2 UNP 114 G +ATOM 814 N N . ALA A 1 115 ? 13.416 1.236 -5.085 1.0 97.62 ? 115 ALA A N 1 V9WDR2 UNP 115 A +ATOM 815 C CA . ALA A 1 115 ? 12.423 0.280 -4.599 1.0 97.62 ? 115 ALA A CA 1 V9WDR2 UNP 115 A +ATOM 816 C C . ALA A 1 115 ? 12.445 -1.036 -5.398 1.0 97.62 ? 115 ALA A C 1 V9WDR2 UNP 115 A +ATOM 817 C CB . ALA A 1 115 ? 11.047 0.959 -4.629 1.0 97.62 ? 115 ALA A CB 1 V9WDR2 UNP 115 A +ATOM 818 O O . ALA A 1 115 ? 13.075 -1.122 -6.459 1.0 97.62 ? 115 ALA A O 1 V9WDR2 UNP 115 A +ATOM 819 N N . ASN A 1 116 ? 11.764 -2.055 -4.871 1.0 97.75 ? 116 ASN A N 1 V9WDR2 UNP 116 N +ATOM 820 C CA . ASN A 1 116 ? 11.449 -3.275 -5.605 1.0 97.75 ? 116 ASN A CA 1 V9WDR2 UNP 116 N +ATOM 821 C C . ASN A 1 116 ? 9.934 -3.489 -5.642 1.0 97.75 ? 116 ASN A C 1 V9WDR2 UNP 116 N +ATOM 822 C CB . ASN A 1 116 ? 12.122 -4.510 -4.980 1.0 97.75 ? 116 ASN A CB 1 V9WDR2 UNP 116 N +ATOM 823 O O . ASN A 1 116 ? 9.335 -3.694 -4.588 1.0 97.75 ? 116 ASN A O 1 V9WDR2 UNP 116 N +ATOM 824 C CG . ASN A 1 116 ? 13.621 -4.408 -4.814 1.0 97.75 ? 116 ASN A CG 1 V9WDR2 UNP 116 N +ATOM 825 N ND2 . ASN A 1 116 ? 14.086 -4.337 -3.591 1.0 97.75 ? 116 ASN A ND2 1 V9WDR2 UNP 116 N +ATOM 826 O OD1 . ASN A 1 116 ? 14.404 -4.465 -5.751 1.0 97.75 ? 116 ASN A OD1 1 V9WDR2 UNP 116 N +ATOM 827 N N . ARG A 1 117 ? 9.343 -3.577 -6.834 1.0 96.31 ? 117 ARG A N 1 V9WDR2 UNP 117 R +ATOM 828 C CA . ARG A 1 117 ? 7.926 -3.929 -6.992 1.0 96.31 ? 117 ARG A CA 1 V9WDR2 UNP 117 R +ATOM 829 C C . ARG A 1 117 ? 7.737 -5.223 -7.750 1.0 96.31 ? 117 ARG A C 1 V9WDR2 UNP 117 R +ATOM 830 C CB . ARG A 1 117 ? 7.148 -2.768 -7.618 1.0 96.31 ? 117 ARG A CB 1 V9WDR2 UNP 117 R +ATOM 831 O O . ARG A 1 117 ? 8.431 -5.509 -8.725 1.0 96.31 ? 117 ARG A O 1 V9WDR2 UNP 117 R +ATOM 832 C CG . ARG A 1 117 ? 5.640 -3.044 -7.784 1.0 96.31 ? 117 ARG A CG 1 V9WDR2 UNP 117 R +ATOM 833 C CD . ARG A 1 117 ? 4.839 -1.888 -8.390 1.0 96.31 ? 117 ARG A CD 1 V9WDR2 UNP 117 R +ATOM 834 N NE . ARG A 1 117 ? 5.189 -0.591 -7.802 1.0 96.31 ? 117 ARG A NE 1 V9WDR2 UNP 117 R +ATOM 835 N NH1 . ARG A 1 117 ? 6.447 0.214 -9.546 1.0 96.31 ? 117 ARG A NH1 1 V9WDR2 UNP 117 R +ATOM 836 N NH2 . ARG A 1 117 ? 6.041 1.452 -7.686 1.0 96.31 ? 117 ARG A NH2 1 V9WDR2 UNP 117 R +ATOM 837 C CZ . ARG A 1 117 ? 5.901 0.355 -8.362 1.0 96.31 ? 117 ARG A CZ 1 V9WDR2 UNP 117 R +ATOM 838 N N . THR A 1 118 ? 6.744 -5.988 -7.327 1.0 97.12 ? 118 THR A N 1 V9WDR2 UNP 118 T +ATOM 839 C CA . THR A 1 118 ? 6.126 -7.034 -8.141 1.0 97.12 ? 118 THR A CA 1 V9WDR2 UNP 118 T +ATOM 840 C C . THR A 1 118 ? 4.662 -6.677 -8.362 1.0 97.12 ? 118 THR A C 1 V9WDR2 UNP 118 T +ATOM 841 C CB . THR A 1 118 ? 6.282 -8.403 -7.476 1.0 97.12 ? 118 THR A CB 1 V9WDR2 UNP 118 T +ATOM 842 O O . THR A 1 118 ? 3.946 -6.471 -7.391 1.0 97.12 ? 118 THR A O 1 V9WDR2 UNP 118 T +ATOM 843 C CG2 . THR A 1 118 ? 5.763 -9.538 -8.354 1.0 97.12 ? 118 THR A CG2 1 V9WDR2 UNP 118 T +ATOM 844 O OG1 . THR A 1 118 ? 7.658 -8.637 -7.251 1.0 97.12 ? 118 THR A OG1 1 V9WDR2 UNP 118 T +ATOM 845 N N . ALA A 1 119 ? 4.228 -6.601 -9.614 1.0 94.94 ? 119 ALA A N 1 V9WDR2 UNP 119 A +ATOM 846 C CA . ALA A 1 119 ? 2.822 -6.453 -9.981 1.0 94.94 ? 119 ALA A CA 1 V9WDR2 UNP 119 A +ATOM 847 C C . ALA A 1 119 ? 2.464 -7.497 -11.043 1.0 94.94 ? 119 ALA A C 1 V9WDR2 UNP 119 A +ATOM 848 C CB . ALA A 1 119 ? 2.544 -5.012 -10.415 1.0 94.94 ? 119 ALA A CB 1 V9WDR2 UNP 119 A +ATOM 849 O O . ALA A 1 119 ? 3.360 -7.972 -11.738 1.0 94.94 ? 119 ALA A O 1 V9WDR2 UNP 119 A +ATOM 850 N N . ALA A 1 120 ? 1.205 -7.898 -11.182 1.0 95.56 ? 120 ALA A N 1 V9WDR2 UNP 120 A +ATOM 851 C CA . ALA A 1 120 ? 0.778 -8.554 -12.414 1.0 95.56 ? 120 ALA A CA 1 V9WDR2 UNP 120 A +ATOM 852 C C . ALA A 1 120 ? 0.743 -7.497 -13.522 1.0 95.56 ? 120 ALA A C 1 V9WDR2 UNP 120 A +ATOM 853 C CB . ALA A 1 120 ? -0.561 -9.273 -12.210 1.0 95.56 ? 120 ALA A CB 1 V9WDR2 UNP 120 A +ATOM 854 O O . ALA A 1 120 ? 1.549 -7.581 -14.457 1.0 95.56 ? 120 ALA A O 1 V9WDR2 UNP 120 A +ATOM 855 N N . ASP A 1 121 ? -0.046 -6.444 -13.308 1.0 96.00 ? 121 ASP A N 1 V9WDR2 UNP 121 D +ATOM 856 C CA . ASP A 1 121 ? -0.283 -5.394 -14.289 1.0 96.00 ? 121 ASP A CA 1 V9WDR2 UNP 121 D +ATOM 857 C C . ASP A 1 121 ? 0.137 -4.021 -13.746 1.0 96.00 ? 121 ASP A C 1 V9WDR2 UNP 121 D +ATOM 858 C CB . ASP A 1 121 ? -1.744 -5.455 -14.773 1.0 96.00 ? 121 ASP A CB 1 V9WDR2 UNP 121 D +ATOM 859 O O . ASP A 1 121 ? 0.065 -3.717 -12.552 1.0 96.00 ? 121 ASP A O 1 V9WDR2 UNP 121 D +ATOM 860 C CG . ASP A 1 121 ? -2.103 -6.813 -15.415 1.0 96.00 ? 121 ASP A CG 1 V9WDR2 UNP 121 D +ATOM 861 O OD1 . ASP A 1 121 ? -1.166 -7.489 -15.905 1.0 96.00 ? 121 ASP A OD1 1 V9WDR2 UNP 121 D +ATOM 862 O OD2 . ASP A 1 121 ? -3.296 -7.176 -15.477 1.0 96.00 ? 121 ASP A OD2 1 V9WDR2 UNP 121 D +ATOM 863 N N . THR A 1 122 ? 0.675 -3.176 -14.626 1.0 95.94 ? 122 THR A N 1 V9WDR2 UNP 122 T +ATOM 864 C CA . THR A 1 122 ? 1.033 -1.794 -14.285 1.0 95.94 ? 122 THR A CA 1 V9WDR2 UNP 122 T +ATOM 865 C C . THR A 1 122 ? 0.722 -0.864 -15.446 1.0 95.94 ? 122 THR A C 1 V9WDR2 UNP 122 T +ATOM 866 C CB . THR A 1 122 ? 2.514 -1.652 -13.903 1.0 95.94 ? 122 THR A CB 1 V9WDR2 UNP 122 T +ATOM 867 O O . THR A 1 122 ? 1.297 -1.030 -16.522 1.0 95.94 ? 122 THR A O 1 V9WDR2 UNP 122 T +ATOM 868 C CG2 . THR A 1 122 ? 2.844 -0.268 -13.344 1.0 95.94 ? 122 THR A CG2 1 V9WDR2 UNP 122 T +ATOM 869 O OG1 . THR A 1 122 ? 2.896 -2.593 -12.922 1.0 95.94 ? 122 THR A OG1 1 V9WDR2 UNP 122 T +ATOM 870 N N . GLU A 1 123 ? -0.123 0.144 -15.252 1.0 97.62 ? 123 GLU A N 1 V9WDR2 UNP 123 E +ATOM 871 C CA . GLU A 1 123 ? -0.450 1.066 -16.346 1.0 97.62 ? 123 GLU A CA 1 V9WDR2 UNP 123 E +ATOM 872 C C . GLU A 1 123 ? 0.695 2.062 -16.575 1.0 97.62 ? 123 GLU A C 1 V9WDR2 UNP 123 E +ATOM 873 C CB . GLU A 1 123 ? -1.811 1.737 -16.112 1.0 97.62 ? 123 GLU A CB 1 V9WDR2 UNP 123 E +ATOM 874 O O . GLU A 1 123 ? 1.279 2.113 -17.659 1.0 97.62 ? 123 GLU A O 1 V9WDR2 UNP 123 E +ATOM 875 C CG . GLU A 1 123 ? -2.347 2.325 -17.426 1.0 97.62 ? 123 GLU A CG 1 V9WDR2 UNP 123 E +ATOM 876 C CD . GLU A 1 123 ? -3.727 2.990 -17.289 1.0 97.62 ? 123 GLU A CD 1 V9WDR2 UNP 123 E +ATOM 877 O OE1 . GLU A 1 123 ? -4.058 3.841 -18.153 1.0 97.62 ? 123 GLU A OE1 1 V9WDR2 UNP 123 E +ATOM 878 O OE2 . GLU A 1 123 ? -4.454 2.632 -16.343 1.0 97.62 ? 123 GLU A OE2 1 V9WDR2 UNP 123 E +ATOM 879 N N . PHE A 1 124 ? 1.115 2.774 -15.527 1.0 97.56 ? 124 PHE A N 1 V9WDR2 UNP 124 F +ATOM 880 C CA . PHE A 1 124 ? 2.176 3.773 -15.587 1.0 97.56 ? 124 PHE A CA 1 V9WDR2 UNP 124 F +ATOM 881 C C . PHE A 1 124 ? 3.237 3.559 -14.510 1.0 97.56 ? 124 PHE A C 1 V9WDR2 UNP 124 F +ATOM 882 C CB . PHE A 1 124 ? 1.575 5.174 -15.452 1.0 97.56 ? 124 PHE A CB 1 V9WDR2 UNP 124 F +ATOM 883 O O . PHE A 1 124 ? 2.965 3.616 -13.314 1.0 97.56 ? 124 PHE A O 1 V9WDR2 UNP 124 F +ATOM 884 C CG . PHE A 1 124 ? 0.633 5.558 -16.570 1.0 97.56 ? 124 PHE A CG 1 V9WDR2 UNP 124 F +ATOM 885 C CD1 . PHE A 1 124 ? 1.136 6.085 -17.774 1.0 97.56 ? 124 PHE A CD1 1 V9WDR2 UNP 124 F +ATOM 886 C CD2 . PHE A 1 124 ? -0.752 5.391 -16.406 1.0 97.56 ? 124 PHE A CD2 1 V9WDR2 UNP 124 F +ATOM 887 C CE1 . PHE A 1 124 ? 0.259 6.416 -18.823 1.0 97.56 ? 124 PHE A CE1 1 V9WDR2 UNP 124 F +ATOM 888 C CE2 . PHE A 1 124 ? -1.627 5.757 -17.438 1.0 97.56 ? 124 PHE A CE2 1 V9WDR2 UNP 124 F +ATOM 889 C CZ . PHE A 1 124 ? -1.125 6.238 -18.657 1.0 97.56 ? 124 PHE A CZ 1 V9WDR2 UNP 124 F +ATOM 890 N N . ALA A 1 125 ? 4.493 3.426 -14.934 1.0 96.31 ? 125 ALA A N 1 V9WDR2 UNP 125 A +ATOM 891 C CA . ALA A 1 125 ? 5.645 3.347 -14.042 1.0 96.31 ? 125 ALA A CA 1 V9WDR2 UNP 125 A +ATOM 892 C C . ALA A 1 125 ? 6.689 4.429 -14.354 1.0 96.31 ? 125 ALA A C 1 V9WDR2 UNP 125 A +ATOM 893 C CB . ALA A 1 125 ? 6.232 1.934 -14.112 1.0 96.31 ? 125 ALA A CB 1 V9WDR2 UNP 125 A +ATOM 894 O O . ALA A 1 125 ? 7.085 4.639 -15.502 1.0 96.31 ? 125 ALA A O 1 V9WDR2 UNP 125 A +ATOM 895 N N . SER A 1 126 ? 7.192 5.090 -13.315 1.0 97.81 ? 126 SER A N 1 V9WDR2 UNP 126 S +ATOM 896 C CA . SER A 1 126 ? 8.355 5.975 -13.364 1.0 97.81 ? 126 SER A CA 1 V9WDR2 UNP 126 S +ATOM 897 C C . SER A 1 126 ? 9.367 5.536 -12.317 1.0 97.81 ? 126 SER A C 1 V9WDR2 UNP 126 S +ATOM 898 C CB . SER A 1 126 ? 7.931 7.427 -13.143 1.0 97.81 ? 126 SER A CB 1 V9WDR2 UNP 126 S +ATOM 899 O O . SER A 1 126 ? 9.114 5.621 -11.120 1.0 97.81 ? 126 SER A O 1 V9WDR2 UNP 126 S +ATOM 900 O OG . SER A 1 126 ? 9.074 8.261 -13.035 1.0 97.81 ? 126 SER A OG 1 V9WDR2 UNP 126 S +ATOM 901 N N . GLU A 1 127 ? 10.543 5.107 -12.752 1.0 96.75 ? 127 GLU A N 1 V9WDR2 UNP 127 E +ATOM 902 C CA . GLU A 1 127 ? 11.485 4.405 -11.892 1.0 96.75 ? 127 GLU A CA 1 V9WDR2 UNP 127 E +ATOM 903 C C . GLU A 1 127 ? 12.882 5.015 -11.954 1.0 96.75 ? 127 GLU A C 1 V9WDR2 UNP 127 E +ATOM 904 C CB . GLU A 1 127 ? 11.563 2.939 -12.311 1.0 96.75 ? 127 GLU A CB 1 V9WDR2 UNP 127 E +ATOM 905 O O . GLU A 1 127 ? 13.444 5.233 -13.029 1.0 96.75 ? 127 GLU A O 1 V9WDR2 UNP 127 E +ATOM 906 C CG . GLU A 1 127 ? 10.241 2.174 -12.190 1.0 96.75 ? 127 GLU A CG 1 V9WDR2 UNP 127 E +ATOM 907 C CD . GLU A 1 127 ? 10.398 0.721 -12.656 1.0 96.75 ? 127 GLU A CD 1 V9WDR2 UNP 127 E +ATOM 908 O OE1 . GLU A 1 127 ? 9.352 0.108 -12.958 1.0 96.75 ? 127 GLU A OE1 1 V9WDR2 UNP 127 E +ATOM 909 O OE2 . GLU A 1 127 ? 11.554 0.255 -12.815 1.0 96.75 ? 127 GLU A OE2 1 V9WDR2 UNP 127 E +ATOM 910 N N . VAL A 1 128 ? 13.503 5.192 -10.789 1.0 97.75 ? 128 VAL A N 1 V9WDR2 UNP 128 V +ATOM 911 C CA . VAL A 1 128 ? 14.907 5.584 -10.659 1.0 97.75 ? 128 VAL A CA 1 V9WDR2 UNP 128 V +ATOM 912 C C . VAL A 1 128 ? 15.636 4.588 -9.769 1.0 97.75 ? 128 VAL A C 1 V9WDR2 UNP 128 V +ATOM 913 C CB . VAL A 1 128 ? 15.052 7.019 -10.125 1.0 97.75 ? 128 VAL A CB 1 V9WDR2 UNP 128 V +ATOM 914 O O . VAL A 1 128 ? 15.389 4.517 -8.566 1.0 97.75 ? 128 VAL A O 1 V9WDR2 UNP 128 V +ATOM 915 C CG1 . VAL A 1 128 ? 16.533 7.429 -10.079 1.0 97.75 ? 128 VAL A CG1 1 V9WDR2 UNP 128 V +ATOM 916 C CG2 . VAL A 1 128 ? 14.308 8.040 -10.996 1.0 97.75 ? 128 VAL A CG2 1 V9WDR2 UNP 128 V +ATOM 917 N N . ARG A 1 129 ? 16.606 3.861 -10.335 1.0 97.06 ? 129 ARG A N 1 V9WDR2 UNP 129 R +ATOM 918 C CA . ARG A 1 129 ? 17.394 2.845 -9.608 1.0 97.06 ? 129 ARG A CA 1 V9WDR2 UNP 129 R +ATOM 919 C C . ARG A 1 129 ? 16.521 1.765 -8.962 1.0 97.06 ? 129 ARG A C 1 V9WDR2 UNP 129 R +ATOM 920 C CB . ARG A 1 129 ? 18.334 3.497 -8.575 1.0 97.06 ? 129 ARG A CB 1 V9WDR2 UNP 129 R +ATOM 921 O O . ARG A 1 129 ? 16.886 1.256 -7.905 1.0 97.06 ? 129 ARG A O 1 V9WDR2 UNP 129 R +ATOM 922 C CG . ARG A 1 129 ? 19.309 4.495 -9.190 1.0 97.06 ? 129 ARG A CG 1 V9WDR2 UNP 129 R +ATOM 923 C CD . ARG A 1 129 ? 20.096 5.173 -8.073 1.0 97.06 ? 129 ARG A CD 1 V9WDR2 UNP 129 R +ATOM 924 N NE . ARG A 1 129 ? 21.070 6.119 -8.636 1.0 97.06 ? 129 ARG A NE 1 V9WDR2 UNP 129 R +ATOM 925 N NH1 . ARG A 1 129 ? 22.138 6.610 -6.671 1.0 97.06 ? 129 ARG A NH1 1 V9WDR2 UNP 129 R +ATOM 926 N NH2 . ARG A 1 129 ? 22.796 7.593 -8.572 1.0 97.06 ? 129 ARG A NH2 1 V9WDR2 UNP 129 R +ATOM 927 C CZ . ARG A 1 129 ? 21.996 6.767 -7.959 1.0 97.06 ? 129 ARG A CZ 1 V9WDR2 UNP 129 R +ATOM 928 N N . ALA A 1 130 ? 15.385 1.451 -9.570 1.0 96.44 ? 130 ALA A N 1 V9WDR2 UNP 130 A +ATOM 929 C CA . ALA A 1 130 ? 14.425 0.496 -9.036 1.0 96.44 ? 130 ALA A CA 1 V9WDR2 UNP 130 A +ATOM 930 C C . ALA A 1 130 ? 14.462 -0.832 -9.803 1.0 96.44 ? 130 ALA A C 1 V9WDR2 UNP 130 A +ATOM 931 C CB . ALA A 1 130 ? 13.048 1.154 -9.018 1.0 96.44 ? 130 ALA A CB 1 V9WDR2 UNP 130 A +ATOM 932 O O . ALA A 1 130 ? 15.147 -0.964 -10.827 1.0 96.44 ? 130 ALA A O 1 V9WDR2 UNP 130 A +ATOM 933 N N . ASN A 1 131 ? 13.781 -1.836 -9.265 1.0 96.19 ? 131 ASN A N 1 V9WDR2 UNP 131 N +ATOM 934 C CA . ASN A 1 131 ? 13.653 -3.142 -9.890 1.0 96.19 ? 131 ASN A CA 1 V9WDR2 UNP 131 N +ATOM 935 C C . ASN A 1 131 ? 12.198 -3.597 -9.838 1.0 96.19 ? 131 ASN A C 1 V9WDR2 UNP 131 N +ATOM 936 C CB . ASN A 1 131 ? 14.596 -4.115 -9.180 1.0 96.19 ? 131 ASN A CB 1 V9WDR2 UNP 131 N +ATOM 937 O O . ASN A 1 131 ? 11.693 -3.960 -8.776 1.0 96.19 ? 131 ASN A O 1 V9WDR2 UNP 131 N +ATOM 938 C CG . ASN A 1 131 ? 14.530 -5.534 -9.710 1.0 96.19 ? 131 ASN A CG 1 V9WDR2 UNP 131 N +ATOM 939 N ND2 . ASN A 1 131 ? 14.726 -6.494 -8.841 1.0 96.19 ? 131 ASN A ND2 1 V9WDR2 UNP 131 N +ATOM 940 O OD1 . ASN A 1 131 ? 14.388 -5.823 -10.887 1.0 96.19 ? 131 ASN A OD1 1 V9WDR2 UNP 131 N +ATOM 941 N N . ARG A 1 132 ? 11.557 -3.637 -10.999 1.0 94.06 ? 132 ARG A N 1 V9WDR2 UNP 132 R +ATOM 942 C CA . ARG A 1 132 ? 10.170 -4.054 -11.130 1.0 94.06 ? 132 ARG A CA 1 V9WDR2 UNP 132 R +ATOM 943 C C . ARG A 1 132 ? 10.069 -5.406 -11.811 1.0 94.06 ? 132 ARG A C 1 V9WDR2 UNP 132 R +ATOM 944 C CB . ARG A 1 132 ? 9.394 -2.950 -11.843 1.0 94.06 ? 132 ARG A CB 1 V9WDR2 UNP 132 R +ATOM 945 O O . ARG A 1 132 ? 10.797 -5.707 -12.753 1.0 94.06 ? 132 ARG A O 1 V9WDR2 UNP 132 R +ATOM 946 C CG . ARG A 1 132 ? 7.887 -3.250 -11.889 1.0 94.06 ? 132 ARG A CG 1 V9WDR2 UNP 132 R +ATOM 947 C CD . ARG A 1 132 ? 7.124 -2.056 -12.454 1.0 94.06 ? 132 ARG A CD 1 V9WDR2 UNP 132 R +ATOM 948 N NE . ARG A 1 132 ? 7.612 -1.736 -13.797 1.0 94.06 ? 132 ARG A NE 1 V9WDR2 UNP 132 R +ATOM 949 N NH1 . ARG A 1 132 ? 5.912 -2.636 -14.957 1.0 94.06 ? 132 ARG A NH1 1 V9WDR2 UNP 132 R +ATOM 950 N NH2 . ARG A 1 132 ? 7.710 -1.839 -16.048 1.0 94.06 ? 132 ARG A NH2 1 V9WDR2 UNP 132 R +ATOM 951 C CZ . ARG A 1 132 ? 7.079 -2.077 -14.936 1.0 94.06 ? 132 ARG A CZ 1 V9WDR2 UNP 132 R +ATOM 952 N N . THR A 1 133 ? 9.141 -6.228 -11.347 1.0 95.19 ? 133 THR A N 1 V9WDR2 UNP 133 T +ATOM 953 C CA . THR A 1 133 ? 8.708 -7.440 -12.041 1.0 95.19 ? 133 THR A CA 1 V9WDR2 UNP 133 T +ATOM 954 C C . THR A 1 133 ? 7.232 -7.307 -12.375 1.0 95.19 ? 133 THR A C 1 V9WDR2 UNP 133 T +ATOM 955 C CB . THR A 1 133 ? 8.997 -8.692 -11.207 1.0 95.19 ? 133 THR A CB 1 V9WDR2 UNP 133 T +ATOM 956 O O . THR A 1 133 ? 6.437 -7.096 -11.465 1.0 95.19 ? 133 THR A O 1 V9WDR2 UNP 133 T +ATOM 957 C CG2 . THR A 1 133 ? 8.679 -9.979 -11.969 1.0 95.19 ? 133 THR A CG2 1 V9WDR2 UNP 133 T +ATOM 958 O OG1 . THR A 1 133 ? 10.375 -8.708 -10.877 1.0 95.19 ? 133 THR A OG1 1 V9WDR2 UNP 133 T +ATOM 959 N N . SER A 1 134 ? 6.875 -7.416 -13.655 1.0 91.88 ? 134 SER A N 1 V9WDR2 UNP 134 S +ATOM 960 C CA . SER A 1 134 ? 5.478 -7.385 -14.101 1.0 91.88 ? 134 SER A CA 1 V9WDR2 UNP 134 S +ATOM 961 C C . SER A 1 134 ? 5.190 -8.368 -15.226 1.0 91.88 ? 134 SER A C 1 V9WDR2 UNP 134 S +ATOM 962 C CB . SER A 1 134 ? 5.023 -5.975 -14.473 1.0 91.88 ? 134 SER A CB 1 V9WDR2 UNP 134 S +ATOM 963 O O . SER A 1 134 ? 6.098 -8.750 -15.970 1.0 91.88 ? 134 SER A O 1 V9WDR2 UNP 134 S +ATOM 964 O OG . SER A 1 134 ? 5.783 -5.516 -15.578 1.0 91.88 ? 134 SER A OG 1 V9WDR2 UNP 134 S +ATOM 965 N N . ALA A 1 135 ? 3.945 -8.826 -15.335 1.0 93.06 ? 135 ALA A N 1 V9WDR2 UNP 135 A +ATOM 966 C CA . ALA A 1 135 ? 3.494 -9.559 -16.511 1.0 93.06 ? 135 ALA A CA 1 V9WDR2 UNP 135 A +ATOM 967 C C . ALA A 1 135 ? 3.233 -8.568 -17.651 1.0 93.06 ? 135 ALA A C 1 V9WDR2 UNP 135 A +ATOM 968 C CB . ALA A 1 135 ? 2.272 -10.413 -16.158 1.0 93.06 ? 135 ALA A CB 1 V9WDR2 UNP 135 A +ATOM 969 O O . ALA A 1 135 ? 3.911 -8.653 -18.681 1.0 93.06 ? 135 ALA A O 1 V9WDR2 UNP 135 A +ATOM 970 N N . ASP A 1 136 ? 2.375 -7.575 -17.404 1.0 92.88 ? 136 ASP A N 1 V9WDR2 UNP 136 D +ATOM 971 C CA . ASP A 1 136 ? 2.019 -6.548 -18.375 1.0 92.88 ? 136 ASP A CA 1 V9WDR2 UNP 136 D +ATOM 972 C C . ASP A 1 136 ? 2.343 -5.133 -17.893 1.0 92.88 ? 136 ASP A C 1 V9WDR2 UNP 136 D +ATOM 973 C CB . ASP A 1 136 ? 0.563 -6.713 -18.836 1.0 92.88 ? 136 ASP A CB 1 V9WDR2 UNP 136 D +ATOM 974 O O . ASP A 1 136 ? 2.459 -4.818 -16.704 1.0 92.88 ? 136 ASP A O 1 V9WDR2 UNP 136 D +ATOM 975 C CG . ASP A 1 136 ? 0.407 -7.927 -19.764 1.0 92.88 ? 136 ASP A CG 1 V9WDR2 UNP 136 D +ATOM 976 O OD1 . ASP A 1 136 ? 1.241 -8.029 -20.700 1.0 92.88 ? 136 ASP A OD1 1 V9WDR2 UNP 136 D +ATOM 977 O OD2 . ASP A 1 136 ? -0.530 -8.735 -19.598 1.0 92.88 ? 136 ASP A OD2 1 V9WDR2 UNP 136 D +ATOM 978 N N . THR A 1 137 ? 2.646 -4.263 -18.855 1.0 93.31 ? 137 THR A N 1 V9WDR2 UNP 137 T +ATOM 979 C CA . THR A 1 137 ? 2.934 -2.850 -18.599 1.0 93.31 ? 137 THR A CA 1 V9WDR2 UNP 137 T +ATOM 980 C C . THR A 1 137 ? 2.608 -2.013 -19.808 1.0 93.31 ? 137 THR A C 1 V9WDR2 UNP 137 T +ATOM 981 C CB . THR A 1 137 ? 4.398 -2.595 -18.245 1.0 93.31 ? 137 THR A CB 1 V9WDR2 UNP 137 T +ATOM 982 O O . THR A 1 137 ? 3.141 -2.286 -20.887 1.0 93.31 ? 137 THR A O 1 V9WDR2 UNP 137 T +ATOM 983 C CG2 . THR A 1 137 ? 4.651 -1.179 -17.723 1.0 93.31 ? 137 THR A CG2 1 V9WDR2 UNP 137 T +ATOM 984 O OG1 . THR A 1 137 ? 4.740 -3.509 -17.239 1.0 93.31 ? 137 THR A OG1 1 V9WDR2 UNP 137 T +ATOM 985 N N . GLU A 1 138 ? 1.804 -0.973 -19.622 1.0 95.25 ? 138 GLU A N 1 V9WDR2 UNP 138 E +ATOM 986 C CA . GLU A 1 138 ? 1.454 -0.083 -20.726 1.0 95.25 ? 138 GLU A CA 1 V9WDR2 UNP 138 E +ATOM 987 C C . GLU A 1 138 ? 2.535 0.974 -20.960 1.0 95.25 ? 138 GLU A C 1 V9WDR2 UNP 138 E +ATOM 988 C CB . GLU A 1 138 ? 0.080 0.556 -20.517 1.0 95.25 ? 138 GLU A CB 1 V9WDR2 UNP 138 E +ATOM 989 O O . GLU A 1 138 ? 3.058 1.110 -22.071 1.0 95.25 ? 138 GLU A O 1 V9WDR2 UNP 138 E +ATOM 990 C CG . GLU A 1 138 ? -1.046 -0.474 -20.337 1.0 95.25 ? 138 GLU A CG 1 V9WDR2 UNP 138 E +ATOM 991 C CD . GLU A 1 138 ? -2.423 0.088 -20.730 1.0 95.25 ? 138 GLU A CD 1 V9WDR2 UNP 138 E +ATOM 992 O OE1 . GLU A 1 138 ? -3.324 -0.749 -20.966 1.0 95.25 ? 138 GLU A OE1 1 V9WDR2 UNP 138 E +ATOM 993 O OE2 . GLU A 1 138 ? -2.523 1.312 -20.971 1.0 95.25 ? 138 GLU A OE2 1 V9WDR2 UNP 138 E +ATOM 994 N N . PHE A 1 139 ? 2.937 1.677 -19.899 1.0 95.06 ? 139 PHE A N 1 V9WDR2 UNP 139 F +ATOM 995 C CA . PHE A 1 139 ? 3.892 2.774 -19.968 1.0 95.06 ? 139 PHE A CA 1 V9WDR2 UNP 139 F +ATOM 996 C C . PHE A 1 139 ? 4.933 2.686 -18.853 1.0 95.06 ? 139 PHE A C 1 V9WDR2 UNP 139 F +ATOM 997 C CB . PHE A 1 139 ? 3.134 4.104 -19.914 1.0 95.06 ? 139 PHE A CB 1 V9WDR2 UNP 139 F +ATOM 998 O O . PHE A 1 139 ? 4.616 2.595 -17.671 1.0 95.06 ? 139 PHE A O 1 V9WDR2 UNP 139 F +ATOM 999 C CG . PHE A 1 139 ? 2.113 4.272 -21.022 1.0 95.06 ? 139 PHE A CG 1 V9WDR2 UNP 139 F +ATOM 1000 C CD1 . PHE A 1 139 ? 2.523 4.642 -22.317 1.0 95.06 ? 139 PHE A CD1 1 V9WDR2 UNP 139 F +ATOM 1001 C CD2 . PHE A 1 139 ? 0.755 4.002 -20.773 1.0 95.06 ? 139 PHE A CD2 1 V9WDR2 UNP 139 F +ATOM 1002 C CE1 . PHE A 1 139 ? 1.577 4.753 -23.354 1.0 95.06 ? 139 PHE A CE1 1 V9WDR2 UNP 139 F +ATOM 1003 C CE2 . PHE A 1 139 ? -0.189 4.110 -21.805 1.0 95.06 ? 139 PHE A CE2 1 V9WDR2 UNP 139 F +ATOM 1004 C CZ . PHE A 1 139 ? 0.220 4.488 -23.095 1.0 95.06 ? 139 PHE A CZ 1 V9WDR2 UNP 139 F +ATOM 1005 N N . ALA A 1 140 ? 6.209 2.777 -19.230 1.0 94.06 ? 140 ALA A N 1 V9WDR2 UNP 140 A +ATOM 1006 C CA . ALA A 1 140 ? 7.316 2.806 -18.283 1.0 94.06 ? 140 ALA A CA 1 V9WDR2 UNP 140 A +ATOM 1007 C C . ALA A 1 140 ? 8.369 3.845 -18.681 1.0 94.06 ? 140 ALA A C 1 V9WDR2 UNP 140 A +ATOM 1008 C CB . ALA A 1 140 ? 7.915 1.403 -18.146 1.0 94.06 ? 140 ALA A CB 1 V9WDR2 UNP 140 A +ATOM 1009 O O . ALA A 1 140 ? 8.757 3.953 -19.848 1.0 94.06 ? 140 ALA A O 1 V9WDR2 UNP 140 A +ATOM 1010 N N . ASN A 1 141 ? 8.855 4.589 -17.691 1.0 95.62 ? 141 ASN A N 1 V9WDR2 UNP 141 N +ATOM 1011 C CA . ASN A 1 141 ? 10.019 5.455 -17.794 1.0 95.62 ? 141 ASN A CA 1 V9WDR2 UNP 141 N +ATOM 1012 C C . ASN A 1 141 ? 11.068 5.017 -16.770 1.0 95.62 ? 141 ASN A C 1 V9WDR2 UNP 141 N +ATOM 1013 C CB . ASN A 1 141 ? 9.586 6.912 -17.597 1.0 95.62 ? 141 ASN A CB 1 V9WDR2 UNP 141 N +ATOM 1014 O O . ASN A 1 141 ? 10.866 5.147 -15.566 1.0 95.62 ? 141 ASN A O 1 V9WDR2 UNP 141 N +ATOM 1015 C CG . ASN A 1 141 ? 10.733 7.890 -17.772 1.0 95.62 ? 141 ASN A CG 1 V9WDR2 UNP 141 N +ATOM 1016 N ND2 . ASN A 1 141 ? 10.494 9.146 -17.483 1.0 95.62 ? 141 ASN A ND2 1 V9WDR2 UNP 141 N +ATOM 1017 O OD1 . ASN A 1 141 ? 11.838 7.578 -18.189 1.0 95.62 ? 141 ASN A OD1 1 V9WDR2 UNP 141 N +ATOM 1018 N N . GLU A 1 142 ? 12.201 4.516 -17.252 1.0 93.50 ? 142 GLU A N 1 V9WDR2 UNP 142 E +ATOM 1019 C CA . GLU A 1 142 ? 13.223 3.888 -16.420 1.0 93.50 ? 142 GLU A CA 1 V9WDR2 UNP 142 E +ATOM 1020 C C . GLU A 1 142 ? 14.549 4.652 -16.494 1.0 93.50 ? 142 GLU A C 1 V9WDR2 UNP 142 E +ATOM 1021 C CB . GLU A 1 142 ? 13.410 2.430 -16.858 1.0 93.50 ? 142 GLU A CB 1 V9WDR2 UNP 142 E +ATOM 1022 O O . GLU A 1 142 ? 15.162 4.793 -17.555 1.0 93.50 ? 142 GLU A O 1 V9WDR2 UNP 142 E +ATOM 1023 C CG . GLU A 1 142 ? 12.197 1.546 -16.522 1.0 93.50 ? 142 GLU A CG 1 V9WDR2 UNP 142 E +ATOM 1024 C CD . GLU A 1 142 ? 12.361 0.111 -17.049 1.0 93.50 ? 142 GLU A CD 1 V9WDR2 UNP 142 E +ATOM 1025 O OE1 . GLU A 1 142 ? 11.324 -0.506 -17.369 1.0 93.50 ? 142 GLU A OE1 1 V9WDR2 UNP 142 E +ATOM 1026 O OE2 . GLU A 1 142 ? 13.523 -0.358 -17.166 1.0 93.50 ? 142 GLU A OE2 1 V9WDR2 UNP 142 E +ATOM 1027 N N . VAL A 1 143 ? 15.053 5.094 -15.341 1.0 94.88 ? 143 VAL A N 1 V9WDR2 UNP 143 V +ATOM 1028 C CA . VAL A 1 143 ? 16.378 5.704 -15.200 1.0 94.88 ? 143 VAL A CA 1 V9WDR2 UNP 143 V +ATOM 1029 C C . VAL A 1 143 ? 17.232 4.816 -14.316 1.0 94.88 ? 143 VAL A C 1 V9WDR2 UNP 143 V +ATOM 1030 C CB . VAL A 1 143 ? 16.302 7.135 -14.642 1.0 94.88 ? 143 VAL A CB 1 V9WDR2 UNP 143 V +ATOM 1031 O O . VAL A 1 143 ? 17.099 4.798 -13.093 1.0 94.88 ? 143 VAL A O 1 V9WDR2 UNP 143 V +ATOM 1032 C CG1 . VAL A 1 143 ? 17.707 7.758 -14.552 1.0 94.88 ? 143 VAL A CG1 1 V9WDR2 UNP 143 V +ATOM 1033 C CG2 . VAL A 1 143 ? 15.440 8.042 -15.526 1.0 94.88 ? 143 VAL A CG2 1 V9WDR2 UNP 143 V +ATOM 1034 N N . THR A 1 144 ? 18.187 4.108 -14.920 1.0 93.44 ? 144 THR A N 1 V9WDR2 UNP 144 T +ATOM 1035 C CA . THR A 1 144 ? 19.050 3.146 -14.205 1.0 93.44 ? 144 THR A CA 1 V9WDR2 UNP 144 T +ATOM 1036 C C . THR A 1 144 ? 18.264 2.062 -13.451 1.0 93.44 ? 144 THR A C 1 V9WDR2 UNP 144 T +ATOM 1037 C CB . THR A 1 144 ? 20.115 3.839 -13.319 1.0 93.44 ? 144 THR A CB 1 V9WDR2 UNP 144 T +ATOM 1038 O O . THR A 1 144 ? 18.753 1.545 -12.448 1.0 93.44 ? 144 THR A O 1 V9WDR2 UNP 144 T +ATOM 1039 C CG2 . THR A 1 144 ? 21.057 4.715 -14.144 1.0 93.44 ? 144 THR A CG2 1 V9WDR2 UNP 144 T +ATOM 1040 O OG1 . THR A 1 144 ? 19.586 4.699 -12.334 1.0 93.44 ? 144 THR A OG1 1 V9WDR2 UNP 144 T +ATOM 1041 N N . SER A 1 145 ? 17.069 1.727 -13.939 1.0 93.50 ? 145 SER A N 1 V9WDR2 UNP 145 S +ATOM 1042 C CA . SER A 1 145 ? 16.173 0.714 -13.371 1.0 93.50 ? 145 SER A CA 1 V9WDR2 UNP 145 S +ATOM 1043 C C . SER A 1 145 ? 16.198 -0.578 -14.188 1.0 93.50 ? 145 SER A C 1 V9WDR2 UNP 145 S +ATOM 1044 C CB . SER A 1 145 ? 14.750 1.270 -13.249 1.0 93.50 ? 145 SER A CB 1 V9WDR2 UNP 145 S +ATOM 1045 O O . SER A 1 145 ? 16.890 -0.666 -15.210 1.0 93.50 ? 145 SER A O 1 V9WDR2 UNP 145 S +ATOM 1046 O OG . SER A 1 145 ? 14.786 2.470 -12.499 1.0 93.50 ? 145 SER A OG 1 V9WDR2 UNP 145 S +ATOM 1047 N N . LYS A 1 146 ? 15.517 -1.609 -13.687 1.0 91.69 ? 146 LYS A N 1 V9WDR2 UNP 146 K +ATOM 1048 C CA . LYS A 1 146 ? 15.361 -2.895 -14.368 1.0 91.69 ? 146 LYS A CA 1 V9WDR2 UNP 146 K +ATOM 1049 C C . LYS A 1 146 ? 13.910 -3.349 -14.302 1.0 91.69 ? 146 LYS A C 1 V9WDR2 UNP 146 K +ATOM 1050 C CB . LYS A 1 146 ? 16.246 -3.965 -13.712 1.0 91.69 ? 146 LYS A CB 1 V9WDR2 UNP 146 K +ATOM 1051 O O . LYS A 1 146 ? 13.405 -3.566 -13.207 1.0 91.69 ? 146 LYS A O 1 V9WDR2 UNP 146 K +ATOM 1052 C CG . LYS A 1 146 ? 17.745 -3.715 -13.896 1.0 91.69 ? 146 LYS A CG 1 V9WDR2 UNP 146 K +ATOM 1053 C CD . LYS A 1 146 ? 18.516 -4.848 -13.219 1.0 91.69 ? 146 LYS A CD 1 V9WDR2 UNP 146 K +ATOM 1054 C CE . LYS A 1 146 ? 20.018 -4.606 -13.342 1.0 91.69 ? 146 LYS A CE 1 V9WDR2 UNP 146 K +ATOM 1055 N NZ . LYS A 1 146 ? 20.757 -5.648 -12.595 1.0 91.69 ? 146 LYS A NZ 1 V9WDR2 UNP 146 K +ATOM 1056 N N . GLN A 1 147 ? 13.319 -3.627 -15.459 1.0 89.00 ? 147 GLN A N 1 V9WDR2 UNP 147 Q +ATOM 1057 C CA . GLN A 1 147 ? 12.096 -4.415 -15.553 1.0 89.00 ? 147 GLN A CA 1 V9WDR2 UNP 147 Q +ATOM 1058 C C . GLN A 1 147 ? 12.399 -5.887 -15.881 1.0 89.00 ? 147 GLN A C 1 V9WDR2 UNP 147 Q +ATOM 1059 C CB . GLN A 1 147 ? 11.149 -3.779 -16.574 1.0 89.00 ? 147 GLN A CB 1 V9WDR2 UNP 147 Q +ATOM 1060 O O . GLN A 1 147 ? 13.073 -6.201 -16.867 1.0 89.00 ? 147 GLN A O 1 V9WDR2 UNP 147 Q +ATOM 1061 C CG . GLN A 1 147 ? 9.794 -4.502 -16.607 1.0 89.00 ? 147 GLN A CG 1 V9WDR2 UNP 147 Q +ATOM 1062 C CD . GLN A 1 147 ? 8.852 -3.991 -17.689 1.0 89.00 ? 147 GLN A CD 1 V9WDR2 UNP 147 Q +ATOM 1063 N NE2 . GLN A 1 147 ? 7.634 -4.484 -17.722 1.0 89.00 ? 147 GLN A NE2 1 V9WDR2 UNP 147 Q +ATOM 1064 O OE1 . GLN A 1 147 ? 9.165 -3.165 -18.527 1.0 89.00 ? 147 GLN A OE1 1 V9WDR2 UNP 147 Q +ATOM 1065 N N . ASN A 1 148 ? 11.831 -6.800 -15.093 1.0 91.25 ? 148 ASN A N 1 V9WDR2 UNP 148 N +ATOM 1066 C CA . ASN A 1 148 ? 11.749 -8.228 -15.389 1.0 91.25 ? 148 ASN A CA 1 V9WDR2 UNP 148 N +ATOM 1067 C C . ASN A 1 148 ? 10.321 -8.581 -15.818 1.0 91.25 ? 148 ASN A C 1 V9WDR2 UNP 148 N +ATOM 1068 C CB . ASN A 1 148 ? 12.180 -9.052 -14.167 1.0 91.25 ? 148 ASN A CB 1 V9WDR2 UNP 148 N +ATOM 1069 O O . ASN A 1 148 ? 9.359 -8.134 -15.199 1.0 91.25 ? 148 ASN A O 1 V9WDR2 UNP 148 N +ATOM 1070 C CG . ASN A 1 148 ? 13.558 -8.677 -13.661 1.0 91.25 ? 148 ASN A CG 1 V9WDR2 UNP 148 N +ATOM 1071 N ND2 . ASN A 1 148 ? 13.659 -8.408 -12.382 1.0 91.25 ? 148 ASN A ND2 1 V9WDR2 UNP 148 N +ATOM 1072 O OD1 . ASN A 1 148 ? 14.536 -8.616 -14.394 1.0 91.25 ? 148 ASN A OD1 1 V9WDR2 UNP 148 N +ATOM 1073 N N . ARG A 1 149 ? 10.180 -9.419 -16.849 1.0 85.00 ? 149 ARG A N 1 V9WDR2 UNP 149 R +ATOM 1074 C CA . ARG A 1 149 ? 8.873 -9.941 -17.263 1.0 85.00 ? 149 ARG A CA 1 V9WDR2 UNP 149 R +ATOM 1075 C C . ARG A 1 149 ? 8.609 -11.316 -16.666 1.0 85.00 ? 149 ARG A C 1 V9WDR2 UNP 149 R +ATOM 1076 C CB . ARG A 1 149 ? 8.698 -9.904 -18.787 1.0 85.00 ? 149 ARG A CB 1 V9WDR2 UNP 149 R +ATOM 1077 O O . ARG A 1 149 ? 9.486 -12.181 -16.731 1.0 85.00 ? 149 ARG A O 1 V9WDR2 UNP 149 R +ATOM 1078 C CG . ARG A 1 149 ? 8.394 -8.469 -19.243 1.0 85.00 ? 149 ARG A CG 1 V9WDR2 UNP 149 R +ATOM 1079 C CD . ARG A 1 149 ? 7.898 -8.407 -20.691 1.0 85.00 ? 149 ARG A CD 1 V9WDR2 UNP 149 R +ATOM 1080 N NE . ARG A 1 149 ? 8.973 -8.110 -21.660 1.0 85.00 ? 149 ARG A NE 1 V9WDR2 UNP 149 R +ATOM 1081 N NH1 . ARG A 1 149 ? 7.561 -7.651 -23.406 1.0 85.00 ? 149 ARG A NH1 1 V9WDR2 UNP 149 R +ATOM 1082 N NH2 . ARG A 1 149 ? 9.754 -7.278 -23.635 1.0 85.00 ? 149 ARG A NH2 1 V9WDR2 UNP 149 R +ATOM 1083 C CZ . ARG A 1 149 ? 8.761 -7.689 -22.894 1.0 85.00 ? 149 ARG A CZ 1 V9WDR2 UNP 149 R +ATOM 1084 N N . CYS A 1 150 ? 7.412 -11.528 -16.122 1.0 71.25 ? 150 CYS A N 1 V9WDR2 UNP 150 C +ATOM 1085 C CA . CYS A 1 150 ? 6.962 -12.863 -15.726 1.0 71.25 ? 150 CYS A CA 1 V9WDR2 UNP 150 C +ATOM 1086 C C . CYS A 1 150 ? 6.687 -13.706 -16.985 1.0 71.25 ? 150 CYS A C 1 V9WDR2 UNP 150 C +ATOM 1087 C CB . CYS A 1 150 ? 5.750 -12.756 -14.784 1.0 71.25 ? 150 CYS A CB 1 V9WDR2 UNP 150 C +ATOM 1088 O O . CYS A 1 150 ? 5.969 -13.277 -17.884 1.0 71.25 ? 150 CYS A O 1 V9WDR2 UNP 150 C +ATOM 1089 S SG . CYS A 1 150 ? 6.230 -13.311 -13.120 1.0 71.25 ? 150 CYS A SG 1 V9WDR2 UNP 150 C +ATOM 1090 N N . GLY A 1 151 ? 7.311 -14.883 -17.092 1.0 59.62 ? 151 GLY A N 1 V9WDR2 UNP 151 G +ATOM 1091 C CA . GLY A 1 151 ? 7.154 -15.765 -18.254 1.0 59.62 ? 151 GLY A CA 1 V9WDR2 UNP 151 G +ATOM 1092 C C . GLY A 1 151 ? 5.750 -16.372 -18.330 1.0 59.62 ? 151 GLY A C 1 V9WDR2 UNP 151 G +ATOM 1093 O O . GLY A 1 151 ? 5.236 -16.827 -17.312 1.0 59.62 ? 151 GLY A O 1 V9WDR2 UNP 151 G +ATOM 1094 N N . HIS A 1 152 ? 5.160 -16.373 -19.529 1.0 47.81 ? 152 HIS A N 1 V9WDR2 UNP 152 H +ATOM 1095 C CA . HIS A 1 152 ? 3.987 -17.185 -19.880 1.0 47.81 ? 152 HIS A CA 1 V9WDR2 UNP 152 H +ATOM 1096 C C . HIS A 1 152 ? 4.379 -18.643 -20.147 1.0 47.81 ? 152 HIS A C 1 V9WDR2 UNP 152 H +ATOM 1097 C CB . HIS A 1 152 ? 3.276 -16.589 -21.106 1.0 47.81 ? 152 HIS A CB 1 V9WDR2 UNP 152 H +ATOM 1098 O O . HIS A 1 152 ? 5.435 -18.860 -20.790 1.0 47.81 ? 152 HIS A O 1 V9WDR2 UNP 152 H +ATOM 1099 C CG . HIS A 1 152 ? 2.374 -15.414 -20.827 1.0 47.81 ? 152 HIS A CG 1 V9WDR2 UNP 152 H +ATOM 1100 C CD2 . HIS A 1 152 ? 1.294 -15.052 -21.584 1.0 47.81 ? 152 HIS A CD2 1 V9WDR2 UNP 152 H +ATOM 1101 N ND1 . HIS A 1 152 ? 2.443 -14.525 -19.777 1.0 47.81 ? 152 HIS A ND1 1 V9WDR2 UNP 152 H +ATOM 1102 C CE1 . HIS A 1 152 ? 1.430 -13.647 -19.904 1.0 47.81 ? 152 HIS A CE1 1 V9WDR2 UNP 152 H +ATOM 1103 N NE2 . HIS A 1 152 ? 0.703 -13.937 -20.996 1.0 47.81 ? 152 HIS A NE2 1 V9WDR2 UNP 152 H +ATOM 1104 O OXT . HIS A 1 152 ? 3.588 -19.517 -19.735 1.0 47.81 ? 152 HIS A OXT 1 V9WDR2 UNP 152 H +# diff --git a/biojava-survival/pom.xml b/biojava-survival/pom.xml index 21588e746b..88f901cdea 100644 --- a/biojava-survival/pom.xml +++ b/biojava-survival/pom.xml @@ -4,7 +4,7 @@ org.biojava biojava - 7.1.2 + 7.2.5-SNAPSHOT biojava-survival diff --git a/biojava-survival/src/main/java/org/biojava/nbio/survival/cox/CoxCC.java b/biojava-survival/src/main/java/org/biojava/nbio/survival/cox/CoxCC.java index a6e4779a44..ccd9d1f238 100644 --- a/biojava-survival/src/main/java/org/biojava/nbio/survival/cox/CoxCC.java +++ b/biojava-survival/src/main/java/org/biojava/nbio/survival/cox/CoxCC.java @@ -30,7 +30,7 @@ /** * - * @author Scooter Willis + * @author Scooter Willis */ public class CoxCC { diff --git a/biojava-survival/src/main/java/org/biojava/nbio/survival/cox/CoxCoefficient.java b/biojava-survival/src/main/java/org/biojava/nbio/survival/cox/CoxCoefficient.java index a8023284b5..d95f85ca76 100644 --- a/biojava-survival/src/main/java/org/biojava/nbio/survival/cox/CoxCoefficient.java +++ b/biojava-survival/src/main/java/org/biojava/nbio/survival/cox/CoxCoefficient.java @@ -25,7 +25,7 @@ /** * - * @author Scooter Willis + * @author Scooter Willis */ public class CoxCoefficient { diff --git a/biojava-survival/src/main/java/org/biojava/nbio/survival/cox/CoxHelper.java b/biojava-survival/src/main/java/org/biojava/nbio/survival/cox/CoxHelper.java index dfc149c54e..4430922993 100644 --- a/biojava-survival/src/main/java/org/biojava/nbio/survival/cox/CoxHelper.java +++ b/biojava-survival/src/main/java/org/biojava/nbio/survival/cox/CoxHelper.java @@ -30,7 +30,7 @@ * Given the number of options for adjusting the calculations using weighting, strata, clustering etc the helper class can be used to hide * the complexity for typical use case. * - * @author Scooter Willis + * @author Scooter Willis */ public class CoxHelper { diff --git a/biojava-survival/src/main/java/org/biojava/nbio/survival/cox/CoxInfo.java b/biojava-survival/src/main/java/org/biojava/nbio/survival/cox/CoxInfo.java index 7bfafba710..c9f4f18056 100644 --- a/biojava-survival/src/main/java/org/biojava/nbio/survival/cox/CoxInfo.java +++ b/biojava-survival/src/main/java/org/biojava/nbio/survival/cox/CoxInfo.java @@ -32,7 +32,7 @@ /** * Holds the results of a cox analysis where calling dump(), toString() will give an output similar to R - * @author Scooter Willis + * @author Scooter Willis */ public class CoxInfo { diff --git a/biojava-survival/src/main/java/org/biojava/nbio/survival/cox/CoxMart.java b/biojava-survival/src/main/java/org/biojava/nbio/survival/cox/CoxMart.java index d49545efa6..9c54c37618 100644 --- a/biojava-survival/src/main/java/org/biojava/nbio/survival/cox/CoxMart.java +++ b/biojava-survival/src/main/java/org/biojava/nbio/survival/cox/CoxMart.java @@ -44,7 +44,7 @@ /** * - * @author Scooter Willis + * @author Scooter Willis */ public class CoxMart { diff --git a/biojava-survival/src/main/java/org/biojava/nbio/survival/cox/CoxMethod.java b/biojava-survival/src/main/java/org/biojava/nbio/survival/cox/CoxMethod.java index 64cfe1fdde..fe26661fd8 100644 --- a/biojava-survival/src/main/java/org/biojava/nbio/survival/cox/CoxMethod.java +++ b/biojava-survival/src/main/java/org/biojava/nbio/survival/cox/CoxMethod.java @@ -22,7 +22,7 @@ /** * - * @author Scooter Willis + * @author Scooter Willis */ public enum CoxMethod{ /** diff --git a/biojava-survival/src/main/java/org/biojava/nbio/survival/cox/CoxR.java b/biojava-survival/src/main/java/org/biojava/nbio/survival/cox/CoxR.java index 943dde980d..d23ded840b 100644 --- a/biojava-survival/src/main/java/org/biojava/nbio/survival/cox/CoxR.java +++ b/biojava-survival/src/main/java/org/biojava/nbio/survival/cox/CoxR.java @@ -75,7 +75,7 @@ * weights(n) :case weights * init :initial estimate for the coefficients * eps :tolerance for convergence. Iteration continues until - * the percent change in loglikelihood is <= eps. + * the percent change in loglikelihood is <= eps. * chol_tol : tolerance for the Cholesky decompostion * method : 0=Breslow, 1=Efron * doscale : 0=don't scale the X matrix, 1=scale the X matrix @@ -106,7 +106,7 @@ *

    * the data must be sorted by ascending time within strata * - * @author Scooter Willis + * @author Scooter Willis */ public class CoxR { diff --git a/biojava-survival/src/main/java/org/biojava/nbio/survival/cox/CoxScore.java b/biojava-survival/src/main/java/org/biojava/nbio/survival/cox/CoxScore.java index cc51ec4d3f..3de88ec20a 100644 --- a/biojava-survival/src/main/java/org/biojava/nbio/survival/cox/CoxScore.java +++ b/biojava-survival/src/main/java/org/biojava/nbio/survival/cox/CoxScore.java @@ -24,7 +24,7 @@ /** * - * @author Scooter Willis + * @author Scooter Willis */ public class CoxScore { diff --git a/biojava-survival/src/main/java/org/biojava/nbio/survival/cox/CoxVariables.java b/biojava-survival/src/main/java/org/biojava/nbio/survival/cox/CoxVariables.java index 7a99f4db02..6b477cb496 100644 --- a/biojava-survival/src/main/java/org/biojava/nbio/survival/cox/CoxVariables.java +++ b/biojava-survival/src/main/java/org/biojava/nbio/survival/cox/CoxVariables.java @@ -25,7 +25,7 @@ /** * - * @author Scooter Willis + * @author Scooter Willis */ public class CoxVariables { diff --git a/biojava-survival/src/main/java/org/biojava/nbio/survival/cox/ResidualsCoxph.java b/biojava-survival/src/main/java/org/biojava/nbio/survival/cox/ResidualsCoxph.java index 94baf9dce8..42b34905cc 100644 --- a/biojava-survival/src/main/java/org/biojava/nbio/survival/cox/ResidualsCoxph.java +++ b/biojava-survival/src/main/java/org/biojava/nbio/survival/cox/ResidualsCoxph.java @@ -29,7 +29,7 @@ /** * - * @author Scooter Willis + * @author Scooter Willis */ public class ResidualsCoxph { diff --git a/biojava-survival/src/main/java/org/biojava/nbio/survival/cox/RiskInfo.java b/biojava-survival/src/main/java/org/biojava/nbio/survival/cox/RiskInfo.java index 9e050b62da..6a8b9c4316 100644 --- a/biojava-survival/src/main/java/org/biojava/nbio/survival/cox/RiskInfo.java +++ b/biojava-survival/src/main/java/org/biojava/nbio/survival/cox/RiskInfo.java @@ -22,7 +22,7 @@ /** * - * @author Scooter Willis + * @author Scooter Willis */ public class RiskInfo { double weight; diff --git a/biojava-survival/src/main/java/org/biojava/nbio/survival/cox/StrataInfo.java b/biojava-survival/src/main/java/org/biojava/nbio/survival/cox/StrataInfo.java index 5cf88613ab..8a50d559fb 100644 --- a/biojava-survival/src/main/java/org/biojava/nbio/survival/cox/StrataInfo.java +++ b/biojava-survival/src/main/java/org/biojava/nbio/survival/cox/StrataInfo.java @@ -27,7 +27,7 @@ /** * Information needed to represent a survival curve * - * @author Scooter Willis + * @author Scooter Willis */ public class StrataInfo { diff --git a/biojava-survival/src/main/java/org/biojava/nbio/survival/cox/SurvFitInfo.java b/biojava-survival/src/main/java/org/biojava/nbio/survival/cox/SurvFitInfo.java index c22e6fb9b5..fa3d30f756 100644 --- a/biojava-survival/src/main/java/org/biojava/nbio/survival/cox/SurvFitInfo.java +++ b/biojava-survival/src/main/java/org/biojava/nbio/survival/cox/SurvFitInfo.java @@ -25,7 +25,7 @@ /** * Contains info for graphing km figures * - * @author Scooter Willis + * @author Scooter Willis */ public class SurvFitInfo { diff --git a/biojava-survival/src/main/java/org/biojava/nbio/survival/cox/SurvivalInfo.java b/biojava-survival/src/main/java/org/biojava/nbio/survival/cox/SurvivalInfo.java index c1ed799293..c60d197682 100644 --- a/biojava-survival/src/main/java/org/biojava/nbio/survival/cox/SurvivalInfo.java +++ b/biojava-survival/src/main/java/org/biojava/nbio/survival/cox/SurvivalInfo.java @@ -29,7 +29,7 @@ * The code handles figuring out if a variables is continuous or categorical. If categorical will * convert to numerical values. * - * @author Scooter Willis + * @author Scooter Willis */ public class SurvivalInfo implements Comparable { diff --git a/biojava-survival/src/main/java/org/biojava/nbio/survival/cox/SurvivalInfoHelper.java b/biojava-survival/src/main/java/org/biojava/nbio/survival/cox/SurvivalInfoHelper.java index 6e292d1633..bf89f51fc8 100644 --- a/biojava-survival/src/main/java/org/biojava/nbio/survival/cox/SurvivalInfoHelper.java +++ b/biojava-survival/src/main/java/org/biojava/nbio/survival/cox/SurvivalInfoHelper.java @@ -27,7 +27,7 @@ /** * Used to work with SurvivalInfo - * @author Scooter Willis + * @author Scooter Willis */ public class SurvivalInfoHelper { diff --git a/biojava-survival/src/main/java/org/biojava/nbio/survival/cox/SurvivalInfoIndex.java b/biojava-survival/src/main/java/org/biojava/nbio/survival/cox/SurvivalInfoIndex.java index 51c443b0b7..1a87f906f4 100644 --- a/biojava-survival/src/main/java/org/biojava/nbio/survival/cox/SurvivalInfoIndex.java +++ b/biojava-survival/src/main/java/org/biojava/nbio/survival/cox/SurvivalInfoIndex.java @@ -22,7 +22,7 @@ /** * Not used and probably should be deleted - * @author Scooter Willis + * @author Scooter Willis */ public class SurvivalInfoIndex implements Comparable { diff --git a/biojava-survival/src/main/java/org/biojava/nbio/survival/cox/WaldTest.java b/biojava-survival/src/main/java/org/biojava/nbio/survival/cox/WaldTest.java index fb011e3cf4..b0996e80e6 100644 --- a/biojava-survival/src/main/java/org/biojava/nbio/survival/cox/WaldTest.java +++ b/biojava-survival/src/main/java/org/biojava/nbio/survival/cox/WaldTest.java @@ -25,7 +25,7 @@ /** * - * @author Scooter Willis + * @author Scooter Willis */ public class WaldTest { //coxph_wtest, df=as.integer(nvar),as.integer(ntest),as.double(var),tests= as.double(b),solve= double(nvar*ntest),as.double(toler.chol)) diff --git a/biojava-survival/src/main/java/org/biojava/nbio/survival/cox/WaldTestInfo.java b/biojava-survival/src/main/java/org/biojava/nbio/survival/cox/WaldTestInfo.java index f5f09d8b03..30cdd1e3f3 100644 --- a/biojava-survival/src/main/java/org/biojava/nbio/survival/cox/WaldTestInfo.java +++ b/biojava-survival/src/main/java/org/biojava/nbio/survival/cox/WaldTestInfo.java @@ -24,7 +24,7 @@ /** * - * @author Scooter Willis + * @author Scooter Willis */ public class WaldTestInfo { diff --git a/biojava-survival/src/main/java/org/biojava/nbio/survival/cox/comparators/CoxComparatorInterface.java b/biojava-survival/src/main/java/org/biojava/nbio/survival/cox/comparators/CoxComparatorInterface.java index 703936e751..fa012ead4d 100644 --- a/biojava-survival/src/main/java/org/biojava/nbio/survival/cox/comparators/CoxComparatorInterface.java +++ b/biojava-survival/src/main/java/org/biojava/nbio/survival/cox/comparators/CoxComparatorInterface.java @@ -27,7 +27,7 @@ /** * - * @author Scooter Willis + * @author Scooter Willis */ public interface CoxComparatorInterface extends Comparator { public String getDescription(); diff --git a/biojava-survival/src/main/java/org/biojava/nbio/survival/cox/comparators/CoxVariablesOverallModelFitComparator.java b/biojava-survival/src/main/java/org/biojava/nbio/survival/cox/comparators/CoxVariablesOverallModelFitComparator.java index 964b1e254f..4ec710d6c1 100644 --- a/biojava-survival/src/main/java/org/biojava/nbio/survival/cox/comparators/CoxVariablesOverallModelFitComparator.java +++ b/biojava-survival/src/main/java/org/biojava/nbio/survival/cox/comparators/CoxVariablesOverallModelFitComparator.java @@ -28,7 +28,7 @@ /** * - * @author Scooter Willis + * @author Scooter Willis */ public class CoxVariablesOverallModelFitComparator implements Comparator, Serializable { private static final long serialVersionUID = 1; diff --git a/biojava-survival/src/main/java/org/biojava/nbio/survival/cox/comparators/CoxVariablesVariableComparator.java b/biojava-survival/src/main/java/org/biojava/nbio/survival/cox/comparators/CoxVariablesVariableComparator.java index 1c48b2dcf0..3c7e2c16d8 100644 --- a/biojava-survival/src/main/java/org/biojava/nbio/survival/cox/comparators/CoxVariablesVariableComparator.java +++ b/biojava-survival/src/main/java/org/biojava/nbio/survival/cox/comparators/CoxVariablesVariableComparator.java @@ -25,7 +25,7 @@ /** * - * @author Scooter Willis + * @author Scooter Willis */ public class CoxVariablesVariableComparator implements CoxComparatorInterface { diff --git a/biojava-survival/src/main/java/org/biojava/nbio/survival/cox/comparators/MeanModelComparator.java b/biojava-survival/src/main/java/org/biojava/nbio/survival/cox/comparators/MeanModelComparator.java index 5f61766a25..4ac6a3f402 100644 --- a/biojava-survival/src/main/java/org/biojava/nbio/survival/cox/comparators/MeanModelComparator.java +++ b/biojava-survival/src/main/java/org/biojava/nbio/survival/cox/comparators/MeanModelComparator.java @@ -28,7 +28,7 @@ /** * - * @author Scooter Willis + * @author Scooter Willis */ public class MeanModelComparator implements Comparator, Serializable { private static final long serialVersionUID = 1; diff --git a/biojava-survival/src/main/java/org/biojava/nbio/survival/cox/comparators/SurvivalInfoComparator.java b/biojava-survival/src/main/java/org/biojava/nbio/survival/cox/comparators/SurvivalInfoComparator.java index f8415af304..899e5e0cb4 100644 --- a/biojava-survival/src/main/java/org/biojava/nbio/survival/cox/comparators/SurvivalInfoComparator.java +++ b/biojava-survival/src/main/java/org/biojava/nbio/survival/cox/comparators/SurvivalInfoComparator.java @@ -27,7 +27,7 @@ /** * - * @author Scooter Willis + * @author Scooter Willis */ public class SurvivalInfoComparator implements Comparator, Serializable { private static final long serialVersionUID = 1; diff --git a/biojava-survival/src/main/java/org/biojava/nbio/survival/cox/comparators/SurvivalInfoValueComparator.java b/biojava-survival/src/main/java/org/biojava/nbio/survival/cox/comparators/SurvivalInfoValueComparator.java index 81098c46cf..f639be0079 100644 --- a/biojava-survival/src/main/java/org/biojava/nbio/survival/cox/comparators/SurvivalInfoValueComparator.java +++ b/biojava-survival/src/main/java/org/biojava/nbio/survival/cox/comparators/SurvivalInfoValueComparator.java @@ -27,7 +27,7 @@ /** * - * @author Scooter Willis + * @author Scooter Willis */ public class SurvivalInfoValueComparator implements Comparator, Serializable { private static final long serialVersionUID = 1; diff --git a/biojava-survival/src/main/java/org/biojava/nbio/survival/cox/stats/AgScore.java b/biojava-survival/src/main/java/org/biojava/nbio/survival/cox/stats/AgScore.java index 7760cbe23d..1a3488b1ec 100644 --- a/biojava-survival/src/main/java/org/biojava/nbio/survival/cox/stats/AgScore.java +++ b/biojava-survival/src/main/java/org/biojava/nbio/survival/cox/stats/AgScore.java @@ -28,7 +28,7 @@ /** * - * @author Scooter Willis + * @author Scooter Willis */ public class AgScore { diff --git a/biojava-survival/src/main/java/org/biojava/nbio/survival/cox/stats/ChiSq.java b/biojava-survival/src/main/java/org/biojava/nbio/survival/cox/stats/ChiSq.java index 4ad714f549..d193e6104b 100644 --- a/biojava-survival/src/main/java/org/biojava/nbio/survival/cox/stats/ChiSq.java +++ b/biojava-survival/src/main/java/org/biojava/nbio/survival/cox/stats/ChiSq.java @@ -22,7 +22,7 @@ /** * - * @author Scooter Willis + * @author Scooter Willis */ public class ChiSq { diff --git a/biojava-survival/src/main/java/org/biojava/nbio/survival/cox/stats/Cholesky2.java b/biojava-survival/src/main/java/org/biojava/nbio/survival/cox/stats/Cholesky2.java index 8c4f81af3b..8ce9f73ff5 100644 --- a/biojava-survival/src/main/java/org/biojava/nbio/survival/cox/stats/Cholesky2.java +++ b/biojava-survival/src/main/java/org/biojava/nbio/survival/cox/stats/Cholesky2.java @@ -22,7 +22,7 @@ /** * - * @author Scooter Willis + * @author Scooter Willis */ public class Cholesky2 { diff --git a/biojava-survival/src/main/java/org/biojava/nbio/survival/cox/stats/Chsolve2.java b/biojava-survival/src/main/java/org/biojava/nbio/survival/cox/stats/Chsolve2.java index dad7d06688..8f62db56c3 100644 --- a/biojava-survival/src/main/java/org/biojava/nbio/survival/cox/stats/Chsolve2.java +++ b/biojava-survival/src/main/java/org/biojava/nbio/survival/cox/stats/Chsolve2.java @@ -22,7 +22,7 @@ /** * - * @author Scooter Willis + * @author Scooter Willis */ public class Chsolve2 { diff --git a/biojava-survival/src/main/java/org/biojava/nbio/survival/data/ChangeValue.java b/biojava-survival/src/main/java/org/biojava/nbio/survival/data/ChangeValue.java index b5841d9f63..5e734a27ba 100644 --- a/biojava-survival/src/main/java/org/biojava/nbio/survival/data/ChangeValue.java +++ b/biojava-survival/src/main/java/org/biojava/nbio/survival/data/ChangeValue.java @@ -23,7 +23,7 @@ /** * - * @author Scooter Willis + * @author Scooter Willis */ public interface ChangeValue { diff --git a/biojava-survival/src/main/java/org/biojava/nbio/survival/data/CompactCharSequence.java b/biojava-survival/src/main/java/org/biojava/nbio/survival/data/CompactCharSequence.java index 68cf58c0a8..eb029560cb 100644 --- a/biojava-survival/src/main/java/org/biojava/nbio/survival/data/CompactCharSequence.java +++ b/biojava-survival/src/main/java/org/biojava/nbio/survival/data/CompactCharSequence.java @@ -25,7 +25,7 @@ /** *http://www.javamex.com/tutorials/memory/ascii_charsequence.shtml - * @author Scooter Willis + * @author Scooter Willis */ public class CompactCharSequence implements CharSequence, Serializable { diff --git a/biojava-survival/src/main/java/org/biojava/nbio/survival/data/HeaderInfo.java b/biojava-survival/src/main/java/org/biojava/nbio/survival/data/HeaderInfo.java index 7357eca3a3..71408271db 100644 --- a/biojava-survival/src/main/java/org/biojava/nbio/survival/data/HeaderInfo.java +++ b/biojava-survival/src/main/java/org/biojava/nbio/survival/data/HeaderInfo.java @@ -22,7 +22,7 @@ /** * - * @author Scooter Willis + * @author Scooter Willis */ public class HeaderInfo { diff --git a/biojava-survival/src/main/java/org/biojava/nbio/survival/data/WorkSheet.java b/biojava-survival/src/main/java/org/biojava/nbio/survival/data/WorkSheet.java index 9e4de21fcc..542085942e 100644 --- a/biojava-survival/src/main/java/org/biojava/nbio/survival/data/WorkSheet.java +++ b/biojava-survival/src/main/java/org/biojava/nbio/survival/data/WorkSheet.java @@ -27,7 +27,7 @@ * Need to handle very large spreadsheets of expression data so keep memory * footprint low * - * @author Scooter Willis + * @author Scooter Willis */ public class WorkSheet { @@ -1464,7 +1464,7 @@ static public WorkSheet readCSV(File f, char delimiter) throws Exception { /** * Read a CSV/Tab delimited file where you pass in the delimiter * - * @param f + * @param is * @param delimiter * @return * @throws Exception diff --git a/biojava-survival/src/main/java/org/biojava/nbio/survival/kaplanmeier/figure/ExpressionFigure.java b/biojava-survival/src/main/java/org/biojava/nbio/survival/kaplanmeier/figure/ExpressionFigure.java index d8d120aee7..51142aeab0 100644 --- a/biojava-survival/src/main/java/org/biojava/nbio/survival/kaplanmeier/figure/ExpressionFigure.java +++ b/biojava-survival/src/main/java/org/biojava/nbio/survival/kaplanmeier/figure/ExpressionFigure.java @@ -35,7 +35,7 @@ /** * - * @author Scooter Willis + * @author Scooter Willis */ public class ExpressionFigure extends JPanel { diff --git a/biojava-survival/src/main/java/org/biojava/nbio/survival/kaplanmeier/figure/GroupResults.java b/biojava-survival/src/main/java/org/biojava/nbio/survival/kaplanmeier/figure/GroupResults.java index abdfe810b6..6c2e0b1b90 100644 --- a/biojava-survival/src/main/java/org/biojava/nbio/survival/kaplanmeier/figure/GroupResults.java +++ b/biojava-survival/src/main/java/org/biojava/nbio/survival/kaplanmeier/figure/GroupResults.java @@ -24,7 +24,7 @@ /** * - * @author Scooter Willis + * @author Scooter Willis */ public class GroupResults { diff --git a/biojava-survival/src/main/java/org/biojava/nbio/survival/kaplanmeier/figure/KMFigureInfo.java b/biojava-survival/src/main/java/org/biojava/nbio/survival/kaplanmeier/figure/KMFigureInfo.java index d17d6afa51..c3b9bed262 100644 --- a/biojava-survival/src/main/java/org/biojava/nbio/survival/kaplanmeier/figure/KMFigureInfo.java +++ b/biojava-survival/src/main/java/org/biojava/nbio/survival/kaplanmeier/figure/KMFigureInfo.java @@ -27,7 +27,7 @@ /** * - * @author Scooter Willis + * @author Scooter Willis */ public class KMFigureInfo { diff --git a/biojava-survival/src/main/java/org/biojava/nbio/survival/kaplanmeier/figure/KaplanMeierFigure.java b/biojava-survival/src/main/java/org/biojava/nbio/survival/kaplanmeier/figure/KaplanMeierFigure.java index f1e8877f97..21e68ccdd0 100644 --- a/biojava-survival/src/main/java/org/biojava/nbio/survival/kaplanmeier/figure/KaplanMeierFigure.java +++ b/biojava-survival/src/main/java/org/biojava/nbio/survival/kaplanmeier/figure/KaplanMeierFigure.java @@ -36,7 +36,7 @@ /** * - * @author Scooter Willis + * @author Scooter Willis */ public class KaplanMeierFigure extends JPanel { diff --git a/biojava-survival/src/main/java/org/biojava/nbio/survival/kaplanmeier/figure/NumbersAtRiskPanel.java b/biojava-survival/src/main/java/org/biojava/nbio/survival/kaplanmeier/figure/NumbersAtRiskPanel.java index dc3e57994e..144942a809 100644 --- a/biojava-survival/src/main/java/org/biojava/nbio/survival/kaplanmeier/figure/NumbersAtRiskPanel.java +++ b/biojava-survival/src/main/java/org/biojava/nbio/survival/kaplanmeier/figure/NumbersAtRiskPanel.java @@ -31,7 +31,7 @@ /** * - * @author Scooter Willis + * @author Scooter Willis */ public class NumbersAtRiskPanel extends JPanel { @@ -76,7 +76,7 @@ private void paintTable(Graphics g) { sfiHashMap = sfi.getStrataInfoHashMap(); } - if(sfiHashMap.size() == 0) + if(sfiHashMap.isEmpty()) return; //int height = this.getHeight(); diff --git a/biojava-survival/src/main/java/org/biojava/nbio/survival/kaplanmeier/figure/SurvFitKM.java b/biojava-survival/src/main/java/org/biojava/nbio/survival/kaplanmeier/figure/SurvFitKM.java index 764c8af76f..0167aa591a 100644 --- a/biojava-survival/src/main/java/org/biojava/nbio/survival/kaplanmeier/figure/SurvFitKM.java +++ b/biojava-survival/src/main/java/org/biojava/nbio/survival/kaplanmeier/figure/SurvFitKM.java @@ -34,7 +34,7 @@ * Ported from survfitKM.S When combining multiple entries with same time not * sure how the weighting adds up * - * @author Scooter Willis + * @author Scooter Willis */ public class SurvFitKM { diff --git a/biojava-survival/src/main/java/org/biojava/nbio/survival/kaplanmeier/metadata/ClinicalMetaDataOutcome.java b/biojava-survival/src/main/java/org/biojava/nbio/survival/kaplanmeier/metadata/ClinicalMetaDataOutcome.java index 3b1ca8fe15..b507f41f97 100644 --- a/biojava-survival/src/main/java/org/biojava/nbio/survival/kaplanmeier/metadata/ClinicalMetaDataOutcome.java +++ b/biojava-survival/src/main/java/org/biojava/nbio/survival/kaplanmeier/metadata/ClinicalMetaDataOutcome.java @@ -27,7 +27,7 @@ /** * - * @author Scooter Willis + * @author Scooter Willis */ public class ClinicalMetaDataOutcome { diff --git a/biojava-survival/src/main/java/org/biojava/nbio/survival/kaplanmeier/metadata/DiscreteQuantizerInterface.java b/biojava-survival/src/main/java/org/biojava/nbio/survival/kaplanmeier/metadata/DiscreteQuantizerInterface.java index 5c80054a72..4d48bd71c3 100644 --- a/biojava-survival/src/main/java/org/biojava/nbio/survival/kaplanmeier/metadata/DiscreteQuantizerInterface.java +++ b/biojava-survival/src/main/java/org/biojava/nbio/survival/kaplanmeier/metadata/DiscreteQuantizerInterface.java @@ -25,7 +25,7 @@ /** * - * @author Scooter Willis + * @author Scooter Willis */ public interface DiscreteQuantizerInterface { /** diff --git a/biojava-survival/src/main/java/org/biojava/nbio/survival/kaplanmeier/metadata/MeanQuantizer.java b/biojava-survival/src/main/java/org/biojava/nbio/survival/kaplanmeier/metadata/MeanQuantizer.java index 964a365cdc..ba64cf1727 100644 --- a/biojava-survival/src/main/java/org/biojava/nbio/survival/kaplanmeier/metadata/MeanQuantizer.java +++ b/biojava-survival/src/main/java/org/biojava/nbio/survival/kaplanmeier/metadata/MeanQuantizer.java @@ -25,7 +25,7 @@ /** * - * @author Scooter Willis + * @author Scooter Willis */ public class MeanQuantizer implements DiscreteQuantizerInterface { diff --git a/biojava-survival/src/main/java/org/biojava/nbio/survival/kaplanmeier/metadata/MetaDataInfo.java b/biojava-survival/src/main/java/org/biojava/nbio/survival/kaplanmeier/metadata/MetaDataInfo.java index bad051b590..75af37ca57 100644 --- a/biojava-survival/src/main/java/org/biojava/nbio/survival/kaplanmeier/metadata/MetaDataInfo.java +++ b/biojava-survival/src/main/java/org/biojava/nbio/survival/kaplanmeier/metadata/MetaDataInfo.java @@ -26,7 +26,7 @@ /** * - * @author Scooter Willis + * @author Scooter Willis */ public class MetaDataInfo { diff --git a/biojava-ws/pom.xml b/biojava-ws/pom.xml index a3c7a30c66..7e960b4445 100644 --- a/biojava-ws/pom.xml +++ b/biojava-ws/pom.xml @@ -3,7 +3,7 @@ biojava org.biojava - 7.1.2 + 7.2.5-SNAPSHOT biojava-ws biojava-ws @@ -19,7 +19,7 @@ org.biojava biojava-core - 7.1.2 + 7.2.5-SNAPSHOT compile diff --git a/biojava-ws/src/main/java/org/biojava/nbio/ws/alignment/qblast/BlastAlignmentParameterEnum.java b/biojava-ws/src/main/java/org/biojava/nbio/ws/alignment/qblast/BlastAlignmentParameterEnum.java index 061475071a..d6389dba98 100644 --- a/biojava-ws/src/main/java/org/biojava/nbio/ws/alignment/qblast/BlastAlignmentParameterEnum.java +++ b/biojava-ws/src/main/java/org/biojava/nbio/ws/alignment/qblast/BlastAlignmentParameterEnum.java @@ -26,7 +26,7 @@ /** * Alignment request parameters accepted by QBlast service.
    * Not all are mandatory. Certain parameters only work with a subset of other parameters in the list. - *

    + *

    * Taken from Blast URL API * * @author Gediminas Rimsa diff --git a/biojava-ws/src/main/java/org/biojava/nbio/ws/alignment/qblast/BlastOutputAlignmentFormatEnum.java b/biojava-ws/src/main/java/org/biojava/nbio/ws/alignment/qblast/BlastOutputAlignmentFormatEnum.java index f414fb475d..13be691e5c 100644 --- a/biojava-ws/src/main/java/org/biojava/nbio/ws/alignment/qblast/BlastOutputAlignmentFormatEnum.java +++ b/biojava-ws/src/main/java/org/biojava/nbio/ws/alignment/qblast/BlastOutputAlignmentFormatEnum.java @@ -25,7 +25,7 @@ /** * Enum representing available output alignment types. - *

    + *

    * Values as used in QBlast URL API. * * @author Gediminas Rimsa diff --git a/biojava-ws/src/main/java/org/biojava/nbio/ws/alignment/qblast/BlastOutputFormatEnum.java b/biojava-ws/src/main/java/org/biojava/nbio/ws/alignment/qblast/BlastOutputFormatEnum.java index 032d7e800a..3ccb1096e6 100644 --- a/biojava-ws/src/main/java/org/biojava/nbio/ws/alignment/qblast/BlastOutputFormatEnum.java +++ b/biojava-ws/src/main/java/org/biojava/nbio/ws/alignment/qblast/BlastOutputFormatEnum.java @@ -25,7 +25,7 @@ /** * Enum representing available output formats. - *

    + *

    * Values are as used by QBlast URL API. * * @author Gediminas Rimsa diff --git a/biojava-ws/src/main/java/org/biojava/nbio/ws/alignment/qblast/BlastOutputParameterEnum.java b/biojava-ws/src/main/java/org/biojava/nbio/ws/alignment/qblast/BlastOutputParameterEnum.java index dfa144864d..b0ed9354fa 100644 --- a/biojava-ws/src/main/java/org/biojava/nbio/ws/alignment/qblast/BlastOutputParameterEnum.java +++ b/biojava-ws/src/main/java/org/biojava/nbio/ws/alignment/qblast/BlastOutputParameterEnum.java @@ -26,7 +26,7 @@ /** * Output parameters accepted by QBlast service.
    * Not all are mandatory. Certain parameters only work with a subset of other parameters in the list. - *

    + *

    * Taken from Blast URL API * * @author Gediminas Rimsa diff --git a/biojava-ws/src/main/java/org/biojava/nbio/ws/alignment/qblast/BlastProgramEnum.java b/biojava-ws/src/main/java/org/biojava/nbio/ws/alignment/qblast/BlastProgramEnum.java index 90c0557c78..ee020bc38d 100644 --- a/biojava-ws/src/main/java/org/biojava/nbio/ws/alignment/qblast/BlastProgramEnum.java +++ b/biojava-ws/src/main/java/org/biojava/nbio/ws/alignment/qblast/BlastProgramEnum.java @@ -25,7 +25,7 @@ /** * Enum representing available blast programs. - *

    + *

    * Values are as used by QBlast URL API. * * @author Gediminas Rimsa diff --git a/biojava-ws/src/main/java/org/biojava/nbio/ws/alignment/qblast/MapToStringTransformer.java b/biojava-ws/src/main/java/org/biojava/nbio/ws/alignment/qblast/MapToStringTransformer.java index 3fc154d009..7da35cb04b 100644 --- a/biojava-ws/src/main/java/org/biojava/nbio/ws/alignment/qblast/MapToStringTransformer.java +++ b/biojava-ws/src/main/java/org/biojava/nbio/ws/alignment/qblast/MapToStringTransformer.java @@ -41,11 +41,11 @@ public class MapToStringTransformer { /** * Creates {@code MapToStringTransformer} with defaults: * - *

    +	 * 
    {@code
     	 * mappingSequence = "=";
     	 * separatorSequence = "&";
     	 * nullValue = "null";
    -	 * 
    + * }
    */ public MapToStringTransformer() { this("=", "&", "null"); @@ -76,7 +76,7 @@ public MapToStringTransformer(String mappingSequence, String separatorSequence, *

    * For example, if we have a map with two entries: {@code ("key1", "1")} and * {@code ("key2", "2")} this method would return {@code "key1=1&key2=2"} if - * {@code mappingSequence} is "=" and separator sequence is "&"; + * {@code mappingSequence} is "=" and separator sequence is "&"; * * @param map map of arguments * @return String resulting string diff --git a/biojava-ws/src/main/java/org/biojava/nbio/ws/alignment/qblast/NCBIQBlastAlignmentProperties.java b/biojava-ws/src/main/java/org/biojava/nbio/ws/alignment/qblast/NCBIQBlastAlignmentProperties.java index 196dc30c90..ccad91b981 100644 --- a/biojava-ws/src/main/java/org/biojava/nbio/ws/alignment/qblast/NCBIQBlastAlignmentProperties.java +++ b/biojava-ws/src/main/java/org/biojava/nbio/ws/alignment/qblast/NCBIQBlastAlignmentProperties.java @@ -36,7 +36,7 @@ * This class wraps a QBlast search request parameter {@code Map} by adding several convenient parameter addition * methods. Other QBlast URL API parameters should be added using * {@link #setAlignmentOption(BlastAlignmentParameterEnum, String)} - *

    + *

    * Required parameters are {@code PROGRAM} and {@code DATABASE}, other parameters are optional * * @author Sylvain Foisy, Diploide BioIT @@ -137,11 +137,9 @@ public String getBlastDatabase() { /** * Sets the database to be used with blastall *

    - * A list of available databases can be acquired by calling {@link NCBIQBlastService#printRemoteBlastInfo()} - *

    * Blastall equivalent: -d * - * @param db : a valid name to a NCBI blastable database + * @param database a valid name to a NCBI blastable database */ public void setBlastDatabase(String database) { setAlignmentOption(DATABASE, database); diff --git a/biojava-ws/src/main/java/org/biojava/nbio/ws/alignment/qblast/NCBIQBlastOutputProperties.java b/biojava-ws/src/main/java/org/biojava/nbio/ws/alignment/qblast/NCBIQBlastOutputProperties.java index 3c38328ae6..6c4b92eb87 100644 --- a/biojava-ws/src/main/java/org/biojava/nbio/ws/alignment/qblast/NCBIQBlastOutputProperties.java +++ b/biojava-ws/src/main/java/org/biojava/nbio/ws/alignment/qblast/NCBIQBlastOutputProperties.java @@ -119,7 +119,7 @@ public String getOutputFormat() { /** * Sets the stream output format to get from the QBlast service - *

    + *

    * If {@code HTML} format is selected, also adds the following parameters (which are removed if another output * format is chosen): * diff --git a/biojava-ws/src/main/java/org/biojava/nbio/ws/alignment/qblast/NCBIQBlastService.java b/biojava-ws/src/main/java/org/biojava/nbio/ws/alignment/qblast/NCBIQBlastService.java index 42fafb0155..5826949426 100644 --- a/biojava-ws/src/main/java/org/biojava/nbio/ws/alignment/qblast/NCBIQBlastService.java +++ b/biojava-ws/src/main/java/org/biojava/nbio/ws/alignment/qblast/NCBIQBlastService.java @@ -248,7 +248,7 @@ public boolean isReady(String id) throws Exception { /** * Checks for completion of request. - *

    + *

    * If expected execution time (RTOE) is available for request, this method will always return false until that time * passes. This is done to prevent sending unnecessary requests to the server. * @@ -307,7 +307,7 @@ public boolean isReady(String id, long present) throws Exception { /** * Extracts the actual Blast report for given request id according to options provided in {@code outputProperties} * argument. - *

    + *

    * If the results are not ready yet, sleeps until they are available. If sleeping is not desired, call this method * after {@code isReady} returns true * diff --git a/biojava-ws/src/main/java/org/biojava/nbio/ws/hmmer/HmmerResult.java b/biojava-ws/src/main/java/org/biojava/nbio/ws/hmmer/HmmerResult.java index 3304e78d4f..373b78cd0a 100644 --- a/biojava-ws/src/main/java/org/biojava/nbio/ws/hmmer/HmmerResult.java +++ b/biojava-ws/src/main/java/org/biojava/nbio/ws/hmmer/HmmerResult.java @@ -140,7 +140,7 @@ public int compareTo(HmmerResult o) { return(me.getSqFrom().compareTo(other.getSqFrom())); } private boolean emptyDomains(HmmerResult o) { - if ( o.getDomains() == null || o.getDomains().size() == 0) + if ( o.getDomains() == null || o.getDomains().isEmpty()) return true; return false; } diff --git a/pom.xml b/pom.xml index 73f7d66d0f..e9f246202b 100644 --- a/pom.xml +++ b/pom.xml @@ -12,7 +12,7 @@ org.biojava biojava pom - 7.1.2 + 7.2.5-SNAPSHOT biojava BioJava is an open-source project dedicated to providing a Java framework for processing biological data. It provides analytical and statistical routines, parsers for common file formats and allows the @@ -44,14 +44,14 @@ 2.23.1 5.10.1 ciftools-java - 5.0.1 + 7.0.1 scm:git:git://github.com/biojava/biojava.git scm:git:git@github.com:biojava/biojava.git https://github.com/biojava/biojava - biojava-7.1.2 + HEAD @@ -247,16 +247,21 @@ org.apache.maven.plugins maven-surefire-plugin - 3.0.0-M5 + 3.5.2 org.apache.maven.plugins maven-shade-plugin 3.2.4 + + org.apache.maven.plugins + maven-project-info-reports-plugin + 3.8.0 + maven-assembly-plugin - 3.3.0 + 3.7.1 src/main/assembly/assembly.xml @@ -275,11 +280,6 @@ - - org.codehaus.mojo - findbugs-maven-plugin - 3.0.5 - org.codehaus.mojo @@ -300,8 +300,9 @@ + org.apache.maven.plugins maven-enforcer-plugin - 3.0.0-M3 + 3.5.0 enforce-java @@ -321,19 +322,25 @@ org.apache.maven.plugins maven-install-plugin - 3.0.0-M1 + 3.1.3 + + + + org.apache.maven.plugins + maven-javadoc-plugin + 3.11.2 org.apache.maven.plugins maven-site-plugin - 3.9.1 + 3.21.0 org.apache.maven.plugins maven-deploy-plugin - 3.0.0-M1 + 3.1.3 @@ -375,10 +382,6 @@ - - org.codehaus.mojo - findbugs-maven-plugin - org.apache.maven.plugins maven-checkstyle-plugin @@ -389,6 +392,14 @@ + + + org.apache.maven.plugins + maven-enforcer-plugin + 3.5.0 + + + @@ -475,7 +486,7 @@ com.google.guava guava - 33.1.0-jre + 33.4.0-jre @@ -484,6 +495,18 @@ maven-javadoc-plugin + + + + aggregate + + aggregate + + + + javadoc:aggregate true @@ -495,8 +518,8 @@ + org.apache.maven.plugins maven-project-info-reports-plugin - 2.9 @@ -512,10 +535,6 @@ - - org.codehaus.mojo - findbugs-maven-plugin - org.apache.maven.plugins @@ -541,6 +560,15 @@ ossrh https://oss.sonatype.org/service/local/staging/deploy/maven2/ + + + + biojava.org + The biojava.org site + + + https://biojava.org/docs/site + @@ -552,17 +580,20 @@ release - - + - org.sonatype.plugins - nexus-staging-maven-plugin - 1.6.13 + org.sonatype.central + central-publishing-maven-plugin + 0.8.0 true - ossrh - https://oss.sonatype.org/ - true + + central + + + true + + published @@ -593,7 +624,7 @@ org.apache.maven.plugins maven-source-plugin - 3.2.0 + 3.3.1 attach-sources @@ -608,7 +639,7 @@ org.apache.maven.plugins maven-javadoc-plugin - 3.2.0 + 3.11.2 attach-javadocs @@ -619,6 +650,22 @@ + + org.apache.maven.plugins + maven-enforcer-plugin + 3.5.0 + + + + org.apache.maven.plugins + maven-site-plugin + 3.21.0 + + + true + + +

    section fieldpreferred location
    #=GF <feature> <Generic per-File annotation, free text>Above the alignment
    #=GC <feature> <Generic per-Column annotation, exactly 1 char per column>Below the alignment
    #=GS <seqname> <feature> <Generic per-Sequence annotation, free text>Above the alignment or just below the corresponding sequence
    #=GR <seqname> <feature> <Generic per-Residue annotation, exactly 1 char per residue>Just below the corresponding sequence