/*

* Licensed to the Apache Software Foundation (ASF) under one or more

* contributor license agreements. See the NOTICE file distributed with

* this work for additional information regarding copyright ownership.

* The ASF licenses this file to You under the Apache License, Version 2.0

* (the "License"); you may not use this file except in compliance with

* the License. You may obtain a copy of the License at

*

* http://www.apache.org/licenses/LICENSE-2.0

*

* Unless required by applicable law or agreed to in writing, software

* distributed under the License is distributed on an "AS IS" BASIS,

* WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.

* See the License for the specific language governing permissions and

* limitations under the License.

*/

package org.apache.jasper.compiler;

import java.lang.reflect.Method;

import java.util.ArrayList;

import java.util.HashMap;

import java.util.Hashtable;

import java.util.Iterator;

import java.util.Locale;

import javax.el.ELException;

import javax.el.ExpressionFactory;

import javax.el.FunctionMapper;

import javax.servlet.jsp.JspFactory;

import javax.servlet.jsp.tagext.FunctionInfo;

import javax.servlet.jsp.tagext.PageData;

import javax.servlet.jsp.tagext.TagAttributeInfo;

import javax.servlet.jsp.tagext.TagData;

import javax.servlet.jsp.tagext.TagExtraInfo;

import javax.servlet.jsp.tagext.TagInfo;

import javax.servlet.jsp.tagext.TagLibraryInfo;

import javax.servlet.jsp.tagext.ValidationMessage;

import org.apache.jasper.JasperException;

import org.apache.jasper.compiler.ELNode.Text;

import org.apache.jasper.el.ELContextImpl;

import org.xml.sax.Attributes;

/**

* Performs validation on the page elements. Attributes are checked for

* mandatory presence, entry value validity, and consistency. As a side effect,

* some page global value (such as those from page directives) are stored, for

* later use.

*

* @author Kin-man Chung

* @author Jan Luehe

* @author Shawn Bayern

* @author Mark Roth

*/

class Validator {

/**

* A visitor to validate and extract page directive info

*/

private static class DirectiveVisitor extends Node.Visitor {

private final PageInfo pageInfo;

private final ErrorDispatcher err;

private static final JspUtil.ValidAttribute[] pageDirectiveAttrs = {

new JspUtil.ValidAttribute("language"),

new JspUtil.ValidAttribute("extends"),

new JspUtil.ValidAttribute("import"),

new JspUtil.ValidAttribute("session"),

new JspUtil.ValidAttribute("buffer"),

new JspUtil.ValidAttribute("autoFlush"),

new JspUtil.ValidAttribute("isThreadSafe"),

new JspUtil.ValidAttribute("info"),

new JspUtil.ValidAttribute("errorPage"),

new JspUtil.ValidAttribute("isErrorPage"),

new JspUtil.ValidAttribute("contentType"),

new JspUtil.ValidAttribute("pageEncoding"),

new JspUtil.ValidAttribute("isELIgnored"),

new JspUtil.ValidAttribute("deferredSyntaxAllowedAsLiteral"),

new JspUtil.ValidAttribute("trimDirectiveWhitespaces")

};

private boolean pageEncodingSeen = false;

/*

* Constructor

*/

DirectiveVisitor(Compiler compiler) {

this.pageInfo = compiler.getPageInfo();

this.err = compiler.getErrorDispatcher();

}

@Override

public void visit(Node.IncludeDirective n) throws JasperException {

// Since pageDirectiveSeen flag only applies to the Current page

// save it here and restore it after the file is included.

boolean pageEncodingSeenSave = pageEncodingSeen;

pageEncodingSeen = false;

visitBody(n);

pageEncodingSeen = pageEncodingSeenSave;

}

@Override

public void visit(Node.PageDirective n) throws JasperException {

JspUtil.checkAttributes("Page directive", n, pageDirectiveAttrs,

err);

// JSP.2.10.1

Attributes attrs = n.getAttributes();

for (int i = 0; attrs != null && i < attrs.getLength(); i++) {

String attr = attrs.getQName(i);

String value = attrs.getValue(i);

if ("language".equals(attr)) {

if (pageInfo.getLanguage(false) == null) {

pageInfo.setLanguage(value, n, err, true);

} else if (!pageInfo.getLanguage(false).equals(value)) {

err.jspError(n, "jsp.error.page.conflict.language",

pageInfo.getLanguage(false), value);

}

} else if ("extends".equals(attr)) {

if (pageInfo.getExtends(false) == null) {

pageInfo.setExtends(value);

} else if (!pageInfo.getExtends(false).equals(value)) {

err.jspError(n, "jsp.error.page.conflict.extends",

pageInfo.getExtends(false), value);

}

} else if ("contentType".equals(attr)) {

if (pageInfo.getContentType() == null) {

pageInfo.setContentType(value);

} else if (!pageInfo.getContentType().equals(value)) {

err.jspError(n, "jsp.error.page.conflict.contenttype",

pageInfo.getContentType(), value);

}

} else if ("session".equals(attr)) {

if (pageInfo.getSession() == null) {

pageInfo.setSession(value, n, err);

} else if (!pageInfo.getSession().equals(value)) {

err.jspError(n, "jsp.error.page.conflict.session",

pageInfo.getSession(), value);

}

} else if ("buffer".equals(attr)) {

if (pageInfo.getBufferValue() == null) {

pageInfo.setBufferValue(value, n, err);

} else if (!pageInfo.getBufferValue().equals(value)) {

err.jspError(n, "jsp.error.page.conflict.buffer",

pageInfo.getBufferValue(), value);

}

} else if ("autoFlush".equals(attr)) {

if (pageInfo.getAutoFlush() == null) {

pageInfo.setAutoFlush(value, n, err);

} else if (!pageInfo.getAutoFlush().equals(value)) {

err.jspError(n, "jsp.error.page.conflict.autoflush",

pageInfo.getAutoFlush(), value);

}

} else if ("isThreadSafe".equals(attr)) {

if (pageInfo.getIsThreadSafe() == null) {

pageInfo.setIsThreadSafe(value, n, err);

} else if (!pageInfo.getIsThreadSafe().equals(value)) {

err.jspError(n, "jsp.error.page.conflict.isthreadsafe",

pageInfo.getIsThreadSafe(), value);

}

} else if ("isELIgnored".equals(attr)) {

if (pageInfo.getIsELIgnored() == null) {

pageInfo.setIsELIgnored(value, n, err, true);

} else if (!pageInfo.getIsELIgnored().equals(value)) {

err.jspError(n, "jsp.error.page.conflict.iselignored",

pageInfo.getIsELIgnored(), value);

}

} else if ("isErrorPage".equals(attr)) {

if (pageInfo.getIsErrorPage() == null) {

pageInfo.setIsErrorPage(value, n, err);

} else if (!pageInfo.getIsErrorPage().equals(value)) {

err.jspError(n, "jsp.error.page.conflict.iserrorpage",

pageInfo.getIsErrorPage(), value);

}

} else if ("errorPage".equals(attr)) {

if (pageInfo.getErrorPage() == null) {

pageInfo.setErrorPage(value);

} else if (!pageInfo.getErrorPage().equals(value)) {

err.jspError(n, "jsp.error.page.conflict.errorpage",

pageInfo.getErrorPage(), value);

}

} else if ("info".equals(attr)) {

if (pageInfo.getInfo() == null) {

pageInfo.setInfo(value);

} else if (!pageInfo.getInfo().equals(value)) {

err.jspError(n, "jsp.error.page.conflict.info",

pageInfo.getInfo(), value);

}

} else if ("pageEncoding".equals(attr)) {

if (pageEncodingSeen)

err.jspError(n, "jsp.error.page.multi.pageencoding");

// 'pageEncoding' can occur at most once per file

pageEncodingSeen = true;

String actual = comparePageEncodings(value, n);

n.getRoot().setPageEncoding(actual);

} else if ("deferredSyntaxAllowedAsLiteral".equals(attr)) {

if (pageInfo.getDeferredSyntaxAllowedAsLiteral() == null) {

pageInfo.setDeferredSyntaxAllowedAsLiteral(value, n,

err, true);

} else if (!pageInfo.getDeferredSyntaxAllowedAsLiteral()

.equals(value)) {

err

.jspError(

n,

"jsp.error.page.conflict.deferredsyntaxallowedasliteral",

pageInfo

.getDeferredSyntaxAllowedAsLiteral(),

value);

}

} else if ("trimDirectiveWhitespaces".equals(attr)) {

if (pageInfo.getTrimDirectiveWhitespaces() == null) {

pageInfo.setTrimDirectiveWhitespaces(value, n, err,

true);

} else if (!pageInfo.getTrimDirectiveWhitespaces().equals(

value)) {

err

.jspError(

n,

"jsp.error.page.conflict.trimdirectivewhitespaces",

pageInfo.getTrimDirectiveWhitespaces(),

value);

}

}

}

// Check for bad combinations

if (pageInfo.getBuffer() == 0 && !pageInfo.isAutoFlush())

err.jspError(n, "jsp.error.page.badCombo");

// Attributes for imports for this node have been processed by

// the parsers, just add them to pageInfo.

pageInfo.addImports(n.getImports());

}

@Override

public void visit(Node.TagDirective n) throws JasperException {

// Note: Most of the validation is done in TagFileProcessor

// when it created a TagInfo object from the

// tag file in which the directive appeared.

// This method does additional processing to collect page info

Attributes attrs = n.getAttributes();

for (int i = 0; attrs != null && i < attrs.getLength(); i++) {

String attr = attrs.getQName(i);

String value = attrs.getValue(i);

if ("language".equals(attr)) {

if (pageInfo.getLanguage(false) == null) {

pageInfo.setLanguage(value, n, err, false);

} else if (!pageInfo.getLanguage(false).equals(value)) {

err.jspError(n, "jsp.error.tag.conflict.language",

pageInfo.getLanguage(false), value);

}

} else if ("isELIgnored".equals(attr)) {

if (pageInfo.getIsELIgnored() == null) {

pageInfo.setIsELIgnored(value, n, err, false);

} else if (!pageInfo.getIsELIgnored().equals(value)) {

err.jspError(n, "jsp.error.tag.conflict.iselignored",

pageInfo.getIsELIgnored(), value);

}

} else if ("pageEncoding".equals(attr)) {

if (pageEncodingSeen)

err.jspError(n, "jsp.error.tag.multi.pageencoding");

pageEncodingSeen = true;

compareTagEncodings(value, n);

n.getRoot().setPageEncoding(value);

} else if ("deferredSyntaxAllowedAsLiteral".equals(attr)) {

if (pageInfo.getDeferredSyntaxAllowedAsLiteral() == null) {

pageInfo.setDeferredSyntaxAllowedAsLiteral(value, n,

err, false);

} else if (!pageInfo.getDeferredSyntaxAllowedAsLiteral()

.equals(value)) {

err

.jspError(

n,

"jsp.error.tag.conflict.deferredsyntaxallowedasliteral",

pageInfo

.getDeferredSyntaxAllowedAsLiteral(),

value);

}

} else if ("trimDirectiveWhitespaces".equals(attr)) {

if (pageInfo.getTrimDirectiveWhitespaces() == null) {

pageInfo.setTrimDirectiveWhitespaces(value, n, err,

false);

} else if (!pageInfo.getTrimDirectiveWhitespaces().equals(

value)) {

err

.jspError(

n,

"jsp.error.tag.conflict.trimdirectivewhitespaces",

pageInfo.getTrimDirectiveWhitespaces(),

value);

}

}

}

// Attributes for imports for this node have been processed by

// the parsers, just add them to pageInfo.

pageInfo.addImports(n.getImports());

}

@Override

public void visit(Node.AttributeDirective n) throws JasperException {

// Do nothing, since this attribute directive has already been

// validated by TagFileProcessor when it created a TagInfo object

// from the tag file in which the directive appeared

}

@Override

public void visit(Node.VariableDirective n) throws JasperException {

// Do nothing, since this variable directive has already been

// validated by TagFileProcessor when it created a TagInfo object

// from the tag file in which the directive appeared

}

/*

* Compares page encodings specified in various places, and throws

* exception in case of page encoding mismatch.

*

* @param pageDirEnc The value of the pageEncoding attribute of the page

* directive @param pageDir The page directive node

*

* @throws JasperException in case of page encoding mismatch

*/

private String comparePageEncodings(String thePageDirEnc,

Node.PageDirective pageDir) throws JasperException {

Node.Root root = pageDir.getRoot();

String configEnc = root.getJspConfigPageEncoding();

String pageDirEnc = thePageDirEnc.toUpperCase(Locale.ENGLISH);

/*

* Compare the 'pageEncoding' attribute of the page directive with

* the encoding specified in the JSP config element whose URL

* pattern matches this page. Treat "UTF-16", "UTF-16BE", and

* "UTF-16LE" as identical.

*/

if (configEnc != null) {

configEnc = configEnc.toUpperCase(Locale.ENGLISH);

if (!pageDirEnc.equals(configEnc)

&& (!pageDirEnc.startsWith("UTF-16") || !configEnc

.startsWith("UTF-16"))) {

err.jspError(pageDir,

"jsp.error.config_pagedir_encoding_mismatch",

configEnc, pageDirEnc);

} else {

return configEnc;

}

}

/*

* Compare the 'pageEncoding' attribute of the page directive with

* the encoding specified in the XML prolog (only for XML syntax,

* and only if JSP document contains XML prolog with encoding

* declaration). Treat "UTF-16", "UTF-16BE", and "UTF-16LE" as

* identical.

*/

if ((root.isXmlSyntax() && root.isEncodingSpecifiedInProlog()) || root.isBomPresent()) {

String pageEnc = root.getPageEncoding().toUpperCase(Locale.ENGLISH);

if (!pageDirEnc.equals(pageEnc)

&& (!pageDirEnc.startsWith("UTF-16") || !pageEnc

.startsWith("UTF-16"))) {

err.jspError(pageDir,

"jsp.error.prolog_pagedir_encoding_mismatch",

pageEnc, pageDirEnc);

} else {

return pageEnc;

}

}

return pageDirEnc;

}

/*

* Compares page encodings specified in various places, and throws

* exception in case of page encoding mismatch.

*

* @param thePageDirEnc The value of the pageEncoding attribute of the page

* directive @param pageDir The page directive node

*

* @throws JasperException in case of page encoding mismatch

*/

private void compareTagEncodings(String thePageDirEnc,

Node.TagDirective pageDir) throws JasperException {

Node.Root root = pageDir.getRoot();

String pageDirEnc = thePageDirEnc.toUpperCase(Locale.ENGLISH);

/*

* Compare the 'pageEncoding' attribute of the page directive with

* the encoding specified in the XML prolog (only for XML syntax,

* and only if JSP document contains XML prolog with encoding

* declaration). Treat "UTF-16", "UTF-16BE", and "UTF-16LE" as

* identical.

*/

if ((root.isXmlSyntax() && root.isEncodingSpecifiedInProlog()) || root.isBomPresent()) {

String pageEnc = root.getPageEncoding().toUpperCase(Locale.ENGLISH);

if (!pageDirEnc.equals(pageEnc)

&& (!pageDirEnc.startsWith("UTF-16") || !pageEnc

.startsWith("UTF-16"))) {

err.jspError(pageDir,

"jsp.error.prolog_pagedir_encoding_mismatch",

pageEnc, pageDirEnc);

}

}

}

}

/**

* A visitor for validating nodes other than page directives

*/

private static class ValidateVisitor extends Node.Visitor {

private final PageInfo pageInfo;

private final ErrorDispatcher err;

private final ClassLoader loader;

private final StringBuilder buf = new StringBuilder(32);

private static final JspUtil.ValidAttribute[] jspRootAttrs = {

new JspUtil.ValidAttribute("xsi:schemaLocation"),

new JspUtil.ValidAttribute("version", true) };

private static final JspUtil.ValidAttribute[] includeDirectiveAttrs = { new JspUtil.ValidAttribute(

"file", true) };

private static final JspUtil.ValidAttribute[] taglibDirectiveAttrs = {

new JspUtil.ValidAttribute("uri"),

new JspUtil.ValidAttribute("tagdir"),

new JspUtil.ValidAttribute("prefix", true) };

private static final JspUtil.ValidAttribute[] includeActionAttrs = {

new JspUtil.ValidAttribute("page", true),

new JspUtil.ValidAttribute("flush") };

private static final JspUtil.ValidAttribute[] paramActionAttrs = {

new JspUtil.ValidAttribute("name", true),

new JspUtil.ValidAttribute("value", true) };

private static final JspUtil.ValidAttribute[] forwardActionAttrs = {

new JspUtil.ValidAttribute("page", true) };

private static final JspUtil.ValidAttribute[] getPropertyAttrs = {

new JspUtil.ValidAttribute("name", true),

new JspUtil.ValidAttribute("property", true) };

private static final JspUtil.ValidAttribute[] setPropertyAttrs = {

new JspUtil.ValidAttribute("name", true),

new JspUtil.ValidAttribute("property", true),

new JspUtil.ValidAttribute("value", false),

new JspUtil.ValidAttribute("param") };

private static final JspUtil.ValidAttribute[] useBeanAttrs = {

new JspUtil.ValidAttribute("id", true),

new JspUtil.ValidAttribute("scope"),

new JspUtil.ValidAttribute("class"),

new JspUtil.ValidAttribute("type"),

new JspUtil.ValidAttribute("beanName", false) };

private static final JspUtil.ValidAttribute[] plugInAttrs = {

new JspUtil.ValidAttribute("type", true),

new JspUtil.ValidAttribute("code", true),

new JspUtil.ValidAttribute("codebase"),

new JspUtil.ValidAttribute("align"),

new JspUtil.ValidAttribute("archive"),

new JspUtil.ValidAttribute("height", false),

new JspUtil.ValidAttribute("hspace"),

new JspUtil.ValidAttribute("jreversion"),

new JspUtil.ValidAttribute("name"),

new JspUtil.ValidAttribute("vspace"),

new JspUtil.ValidAttribute("width", false),

new JspUtil.ValidAttribute("nspluginurl"),

new JspUtil.ValidAttribute("iepluginurl") };

private static final JspUtil.ValidAttribute[] attributeAttrs = {

new JspUtil.ValidAttribute("name", true),

new JspUtil.ValidAttribute("trim"),

new JspUtil.ValidAttribute("omit")};

private static final JspUtil.ValidAttribute[] invokeAttrs = {

new JspUtil.ValidAttribute("fragment", true),

new JspUtil.ValidAttribute("var"),

new JspUtil.ValidAttribute("varReader"),

new JspUtil.ValidAttribute("scope") };

private static final JspUtil.ValidAttribute[] doBodyAttrs = {

new JspUtil.ValidAttribute("var"),

new JspUtil.ValidAttribute("varReader"),

new JspUtil.ValidAttribute("scope") };

private static final JspUtil.ValidAttribute[] jspOutputAttrs = {

new JspUtil.ValidAttribute("omit-xml-declaration"),

new JspUtil.ValidAttribute("doctype-root-element"),

new JspUtil.ValidAttribute("doctype-public"),

new JspUtil.ValidAttribute("doctype-system") };

private final ExpressionFactory expressionFactory;

/*

* Constructor

*/

ValidateVisitor(Compiler compiler) {

this.pageInfo = compiler.getPageInfo();

this.err = compiler.getErrorDispatcher();

this.loader = compiler.getCompilationContext().getClassLoader();

// Get the cached EL expression factory for this context

expressionFactory =

JspFactory.getDefaultFactory().getJspApplicationContext(

compiler.getCompilationContext().getServletContext()).

getExpressionFactory();

}

@Override

public void visit(Node.JspRoot n) throws JasperException {

JspUtil.checkAttributes("Jsp:root", n, jspRootAttrs, err);

String version = n.getTextAttribute("version");

if (!version.equals("1.2") && !version.equals("2.0") &&

!version.equals("2.1") && !version.equals("2.2") &&

!version.equals("2.3")) {

err.jspError(n, "jsp.error.jsproot.version.invalid", version);

}

visitBody(n);

}

@Override

public void visit(Node.IncludeDirective n) throws JasperException {

JspUtil.checkAttributes("Include directive", n,

includeDirectiveAttrs, err);

visitBody(n);

}

@Override

public void visit(Node.TaglibDirective n) throws JasperException {

JspUtil.checkAttributes("Taglib directive", n,

taglibDirectiveAttrs, err);

// Either 'uri' or 'tagdir' attribute must be specified

String uri = n.getAttributeValue("uri");

String tagdir = n.getAttributeValue("tagdir");

if (uri == null && tagdir == null) {

err.jspError(n, "jsp.error.taglibDirective.missing.location");

}

if (uri != null && tagdir != null) {

err

.jspError(n,

"jsp.error.taglibDirective.both_uri_and_tagdir");

}

}

@Override

public void visit(Node.ParamAction n) throws JasperException {

JspUtil.checkAttributes("Param action", n, paramActionAttrs, err);

// make sure the value of the 'name' attribute is not a

// request-time expression

throwErrorIfExpression(n, "name", "jsp:param");

n.setValue(getJspAttribute(null, "value", null, null, n

.getAttributeValue("value"), n, null, false));

visitBody(n);

}

@Override

public void visit(Node.ParamsAction n) throws JasperException {

// Make sure we've got at least one nested jsp:param

Node.Nodes subElems = n.getBody();

if (subElems == null) {

err.jspError(n, "jsp.error.params.emptyBody");

}

visitBody(n);

}

@Override

public void visit(Node.IncludeAction n) throws JasperException {

JspUtil.checkAttributes("Include action", n, includeActionAttrs,

err);

n.setPage(getJspAttribute(null, "page", null, null, n

.getAttributeValue("page"), n, null, false));

visitBody(n);

}

@Override

public void visit(Node.ForwardAction n) throws JasperException {

JspUtil.checkAttributes("Forward", n, forwardActionAttrs, err);

n.setPage(getJspAttribute(null, "page", null, null, n

.getAttributeValue("page"), n, null, false));

visitBody(n);

}

@Override

public void visit(Node.GetProperty n) throws JasperException {

JspUtil.checkAttributes("GetProperty", n, getPropertyAttrs, err);

}

@Override

public void visit(Node.SetProperty n) throws JasperException {

JspUtil.checkAttributes("SetProperty", n, setPropertyAttrs, err);

String property = n.getTextAttribute("property");

String param = n.getTextAttribute("param");

String value = n.getAttributeValue("value");

n.setValue(getJspAttribute(null, "value", null, null, value,

n, null, false));

boolean valueSpecified = n.getValue() != null;

if ("*".equals(property)) {

if (param != null || valueSpecified)

err.jspError(n, "jsp.error.setProperty.invalid");

} else if (param != null && valueSpecified) {

err.jspError(n, "jsp.error.setProperty.invalid");

}

visitBody(n);

}

@Override

public void visit(Node.UseBean n) throws JasperException {

JspUtil.checkAttributes("UseBean", n, useBeanAttrs, err);

String name = n.getTextAttribute("id");

String scope = n.getTextAttribute("scope");

JspUtil.checkScope(scope, n, err);

String className = n.getTextAttribute("class");

String type = n.getTextAttribute("type");

BeanRepository beanInfo = pageInfo.getBeanRepository();

if (className == null && type == null)

err.jspError(n, "jsp.error.usebean.missingType");

if (beanInfo.checkVariable(name))

err.jspError(n, "jsp.error.usebean.duplicate");

if ("session".equals(scope) && !pageInfo.isSession())

err.jspError(n, "jsp.error.usebean.noSession");

Node.JspAttribute jattr = getJspAttribute(null, "beanName", null,

null, n.getAttributeValue("beanName"), n, null, false);

n.setBeanName(jattr);

if (className != null && jattr != null)

err.jspError(n, "jsp.error.usebean.notBoth");

if (className == null)

className = type;

beanInfo.addBean(n, name, className, scope);

visitBody(n);

}

@SuppressWarnings("null") // type can't be null after initial test

@Override

public void visit(Node.PlugIn n) throws JasperException {

JspUtil.checkAttributes("Plugin", n, plugInAttrs, err);

throwErrorIfExpression(n, "type", "jsp:plugin");

throwErrorIfExpression(n, "code", "jsp:plugin");

throwErrorIfExpression(n, "codebase", "jsp:plugin");

throwErrorIfExpression(n, "align", "jsp:plugin");

throwErrorIfExpression(n, "archive", "jsp:plugin");

throwErrorIfExpression(n, "hspace", "jsp:plugin");

throwErrorIfExpression(n, "jreversion", "jsp:plugin");

throwErrorIfExpression(n, "name", "jsp:plugin");

throwErrorIfExpression(n, "vspace", "jsp:plugin");

throwErrorIfExpression(n, "nspluginurl", "jsp:plugin");

throwErrorIfExpression(n, "iepluginurl", "jsp:plugin");

String type = n.getTextAttribute("type");

if (type == null)

err.jspError(n, "jsp.error.plugin.notype");

if (!type.equals("bean") && !type.equals("applet"))

err.jspError(n, "jsp.error.plugin.badtype");

if (n.getTextAttribute("code") == null)

err.jspError(n, "jsp.error.plugin.nocode");

Node.JspAttribute width = getJspAttribute(null, "width", null,

null, n.getAttributeValue("width"), n, null, false);

n.setWidth(width);

Node.JspAttribute height = getJspAttribute(null, "height", null,

null, n.getAttributeValue("height"), n, null, false);

n.setHeight(height);

visitBody(n);

}

@Override

public void visit(Node.NamedAttribute n) throws JasperException {

JspUtil.checkAttributes("Attribute", n, attributeAttrs, err);

n.setOmit(getJspAttribute(null, "omit", null, null, n

.getAttributeValue("omit"), n, null, false));

visitBody(n);

}

@Override

public void visit(Node.JspBody n) throws JasperException {

visitBody(n);

}

@Override

public void visit(Node.Declaration n) throws JasperException {

if (pageInfo.isScriptingInvalid()) {

err.jspError(n.getStart(), "jsp.error.no.scriptlets");

}

}

@Override

public void visit(Node.Expression n) throws JasperException {

if (pageInfo.isScriptingInvalid()) {

err.jspError(n.getStart(), "jsp.error.no.scriptlets");

}

}

@Override

public void visit(Node.Scriptlet n) throws JasperException {

if (pageInfo.isScriptingInvalid()) {

err.jspError(n.getStart(), "jsp.error.no.scriptlets");

}

}

@Override

public void visit(Node.ELExpression n) throws JasperException {

// exit if we are ignoring EL all together

if (pageInfo.isELIgnored())

return;

// JSP.2.2 - '#{' not allowed in template text

if (n.getType() == '#') {

if (!pageInfo.isDeferredSyntaxAllowedAsLiteral()) {

err.jspError(n, "jsp.error.el.template.deferred");

} else {

return;

}

}

// build expression

StringBuilder expr = this.getBuffer();

expr.append(n.getType()).append('{').append(n.getText())

.append('}');

ELNode.Nodes el = ELParser.parse(expr.toString(), pageInfo

.isDeferredSyntaxAllowedAsLiteral());

// validate/prepare expression

prepareExpression(el, n, expr.toString());

// store it

n.setEL(el);

}

@Override

public void visit(Node.UninterpretedTag n) throws JasperException {

if (n.getNamedAttributeNodes().size() != 0) {

err.jspError(n, "jsp.error.namedAttribute.invalidUse");

}

Attributes attrs = n.getAttributes();

if (attrs != null) {

int attrSize = attrs.getLength();

Node.JspAttribute[] jspAttrs = new Node.JspAttribute[attrSize];

for (int i = 0; i < attrSize; i++) {

// JSP.2.2 - '#{' not allowed in template text

String value = attrs.getValue(i);

if (!pageInfo.isDeferredSyntaxAllowedAsLiteral()) {

if (containsDeferredSyntax(value)) {

err.jspError(n, "jsp.error.el.template.deferred");

}

}

jspAttrs[i] = getJspAttribute(null, attrs.getQName(i),

attrs.getURI(i), attrs.getLocalName(i), value, n,

null, false);

}

n.setJspAttributes(jspAttrs);

}

visitBody(n);

}

/*

* Look for a #{ sequence that isn't preceded by \.

*/

private boolean containsDeferredSyntax(String value) {

if (value == null) {

return false;

}

int i = 0;

int len = value.length();

boolean prevCharIsEscape = false;

while (i < value.length()) {

char c = value.charAt(i);

if (c == '#' && (i+1) < len && value.charAt(i+1) == '{' && !prevCharIsEscape) {

return true;

} else if (c == '\\') {

prevCharIsEscape = true;

} else {

prevCharIsEscape = false;

}

i++;

}

return false;

}

@SuppressWarnings("null") // tagInfo can't be null after initial test

@Override

public void visit(Node.CustomTag n) throws JasperException {

TagInfo tagInfo = n.getTagInfo();

if (tagInfo == null) {

err.jspError(n, "jsp.error.missing.tagInfo", n.getQName());

}

/*

* The bodycontent of a SimpleTag cannot be JSP.

*/

if (n.implementsSimpleTag()

&& tagInfo.getBodyContent().equalsIgnoreCase(

TagInfo.BODY_CONTENT_JSP)) {

err.jspError(n, "jsp.error.simpletag.badbodycontent", tagInfo

.getTagClassName());

}

/*

* If the tag handler declares in the TLD that it supports dynamic

* attributes, it also must implement the DynamicAttributes

* interface.

*/

if (tagInfo.hasDynamicAttributes()

&& !n.implementsDynamicAttributes()) {

err.jspError(n, "jsp.error.dynamic.attributes.not.implemented",

n.getQName());

}

/*

* Make sure all required attributes are present, either as

* attributes or named attributes (<jsp:attribute>). Also make sure

* that the same attribute is not specified in both attributes or

* named attributes.

*/

TagAttributeInfo[] tldAttrs = tagInfo.getAttributes();

String customActionUri = n.getURI();

Attributes attrs = n.getAttributes();

int attrsSize = (attrs == null) ? 0 : attrs.getLength();

for (int i = 0; i < tldAttrs.length; i++) {

String attr = null;

if (attrs != null) {

attr = attrs.getValue(tldAttrs[i].getName());

if (attr == null) {

attr = attrs.getValue(customActionUri, tldAttrs[i]

.getName());

}

}

Node.NamedAttribute na = n.getNamedAttributeNode(tldAttrs[i]

.getName());

if (tldAttrs[i].isRequired() && attr == null && na == null) {

err.jspError(n, "jsp.error.missing_attribute", tldAttrs[i]

.getName(), n.getLocalName());

}

if (attr != null && na != null) {

err.jspError(n, "jsp.error.duplicate.name.jspattribute",

tldAttrs[i].getName());

}

}

Node.Nodes naNodes = n.getNamedAttributeNodes();

int jspAttrsSize = naNodes.size() + attrsSize;

Node.JspAttribute[] jspAttrs = null;

if (jspAttrsSize > 0) {

jspAttrs = new Node.JspAttribute[jspAttrsSize];

}

Hashtable<String, Object> tagDataAttrs = new Hashtable<>(attrsSize);

checkXmlAttributes(n, jspAttrs, tagDataAttrs);

checkNamedAttributes(n, jspAttrs, attrsSize, tagDataAttrs);

TagData tagData = new TagData(tagDataAttrs);

// JSP.C1: It is a (translation time) error for an action that

// has one or more variable subelements to have a TagExtraInfo

// class that returns a non-null object.

TagExtraInfo tei = tagInfo.getTagExtraInfo();

if (tei != null && tei.getVariableInfo(tagData) != null

&& tei.getVariableInfo(tagData).length > 0

&& tagInfo.getTagVariableInfos().length > 0) {

err.jspError("jsp.error.non_null_tei_and_var_subelems", n

.getQName());

}

n.setTagData(tagData);

n.setJspAttributes(jspAttrs);

visitBody(n);

}

@Override

public void visit(Node.JspElement n) throws JasperException {

Attributes attrs = n.getAttributes();

if (attrs == null) {

err.jspError(n, "jsp.error.jspelement.missing.name");

}

@SuppressWarnings("null") // Exception will have been thrown above

int xmlAttrLen = attrs.getLength();

Node.Nodes namedAttrs = n.getNamedAttributeNodes();

// XML-style 'name' attribute, which is mandatory, must not be

// included in JspAttribute array

int jspAttrSize = xmlAttrLen - 1 + namedAttrs.size();

Node.JspAttribute[] jspAttrs = new Node.JspAttribute[jspAttrSize];

int jspAttrIndex = 0;

// Process XML-style attributes

for (int i = 0; i < xmlAttrLen; i++) {

if ("name".equals(attrs.getLocalName(i))) {

n.setNameAttribute(getJspAttribute(null, attrs.getQName(i),

attrs.getURI(i), attrs.getLocalName(i), attrs

.getValue(i), n, null, false));

} else {

if (jspAttrIndex < jspAttrSize) {

jspAttrs[jspAttrIndex++] = getJspAttribute(null,

attrs.getQName(i), attrs.getURI(i),

attrs.getLocalName(i), attrs.getValue(i), n,

null, false);

}

}

}

if (n.getNameAttribute() == null) {

err.jspError(n, "jsp.error.jspelement.missing.name");

}

// Process named attributes

for (int i = 0; i < namedAttrs.size(); i++) {

Node.NamedAttribute na = (Node.NamedAttribute) namedAttrs

.getNode(i);

jspAttrs[jspAttrIndex++] = new Node.JspAttribute(na, null,

false);

}

n.setJspAttributes(jspAttrs);

visitBody(n);

}

@Override

public void visit(Node.JspOutput n) throws JasperException {

JspUtil.checkAttributes("jsp:output", n, jspOutputAttrs, err);

if (n.getBody() != null) {

err.jspError(n, "jsp.error.jspoutput.nonemptybody");

}

String omitXmlDecl = n.getAttributeValue("omit-xml-declaration");

String doctypeName = n.getAttributeValue("doctype-root-element");

String doctypePublic = n.getAttributeValue("doctype-public");

String doctypeSystem = n.getAttributeValue("doctype-system");

String omitXmlDeclOld = pageInfo.getOmitXmlDecl();

String doctypeNameOld = pageInfo.getDoctypeName();

String doctypePublicOld = pageInfo.getDoctypePublic();

String doctypeSystemOld = pageInfo.getDoctypeSystem();

if (omitXmlDecl != null && omitXmlDeclOld != null

&& !omitXmlDecl.equals(omitXmlDeclOld)) {

err.jspError(n, "jsp.error.jspoutput.conflict",

"omit-xml-declaration", omitXmlDeclOld, omitXmlDecl);

}

if (doctypeName != null && doctypeNameOld != null

&& !doctypeName.equals(doctypeNameOld)) {

err.jspError(n, "jsp.error.jspoutput.conflict",

"doctype-root-element", doctypeNameOld, doctypeName);

}

if (doctypePublic != null && doctypePublicOld != null

&& !doctypePublic.equals(doctypePublicOld)) {

err.jspError(n, "jsp.error.jspoutput.conflict",

"doctype-public", doctypePublicOld, doctypePublic);

}

if (doctypeSystem != null && doctypeSystemOld != null

&& !doctypeSystem.equals(doctypeSystemOld)) {

err.jspError(n, "jsp.error.jspoutput.conflict",

"doctype-system", doctypeSystemOld, doctypeSystem);

}

if (doctypeName == null && doctypeSystem != null

|| doctypeName != null && doctypeSystem == null) {

err.jspError(n, "jsp.error.jspoutput.doctypenamesystem");

}

if (doctypePublic != null && doctypeSystem == null) {

err.jspError(n, "jsp.error.jspoutput.doctypepulicsystem");